KEGG   Roseobacter litoralis Och 149: RLO149_c023590Help
Entry
RLO149_c023590    CDS       T01572                                 

Gene name
speB2
Definition
agmatinase SpeB (EC:3.5.3.11)
Organism
rli  Roseobacter litoralis Och 149
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2419315..2420265)
Genome map
AA seq 316 aa AA seqDB search
MAEKNQPISGNDLARFSGPNTFMRLPMVNDLKGLDVAIVGIPMDIGTSWRSGTRFGPKEV
RAESAMIRPYNMGTGAAPFDSLQVADIGDLAINTFSLAKSLKIVEESYHAILNYDAMPVA
IGGDHSITLPILRAMHKRHGPVALIHVDAHADVNDEMFGERETHGTVFRRAYEEGLILPE
KTYQVGLRGTGYTADDFAEAQGWGFQQFPAQELWHRSLTGLGGEIRRDIGSKTPVYVTYD
IDSLDPAFAPGTGTPEIGGLTTPQAMELIRALRGLNIVGCDLVEVSPPYDASGNTALVGA
NLLFELICVLPGVDYR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaaaaatcaaccgatcagcgggaacgatctggcgcgcttttccggccccaac
actttcatgcgcttgcccatggtcaatgatctcaaggggctggatgtggctattgttggt
attccgatggatatcggcacatcctggcggtcgggcacgcggtttgggcccaaagaggtg
cgcgccgaaagcgcgatgatacggccctataacatgggaacgggcgcggccccctttgac
agcctgcaggtggcagatatcggcgatttggccatcaatacgttctcgctggccaagagc
ctcaagatcgttgaggaaagctaccatgccatcctgaactatgacgcgatgccagtggcc
attggtggggatcattcgatcacattgccgatcttgcgggccatgcataagcgtcatggc
cccgtcgcccttattcacgtggatgcccatgccgatgtaaatgatgaaatgtttggcgaa
agggaaacccatggcaccgtctttcgtcgcgcctacgaagaaggcctgatcctgcctgaa
aaaacctatcaggtcggcttgcgtggcacagggtacacggcagatgatttcgctgaggcg
caggggtggggttttcagcagtttccggcacaggagctttggcaccgcagcctcaccggt
ttgggcggtgagatccgccgcgacattggatcgaaaacacctgtctacgtcacctatgac
atcgacagtctggacccggcctttgcgcccggcacgggcacgcctgagatcggcggcctt
acaaccccgcaagccatggaactgatccgggcgttgagggggctgaatatcgtcggctgt
gaccttgtggaggtctcgccgccctatgatgccagcggcaataccgcgctggtgggcgca
aatcttcttttcgagcttatatgtgttttgcccggcgtcgactatcgctga

DBGET integrated database retrieval system