KEGG   Roseobacter litoralis: RLO149_c025420Help
Entry
RLO149_c025420    CDS       T01572                                 

Gene name
glcB
Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
rli  Roseobacter litoralis
Pathway
rli00620  Pyruvate metabolism
rli00630  Glyoxylate and dicarboxylate metabolism
rli01100  Metabolic pathways
rli01110  Biosynthesis of secondary metabolites
rli01120  Microbial metabolism in diverse environments
rli01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RLO149_c025420 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    RLO149_c025420 (glcB)
Enzymes [BR:rli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RLO149_c025420 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AEI94510
UniProt: F7ZCT6
Position
complement(2604530..2606677)
Genome map
AA seq 715 aa AA seqDB search
MTGFQTKCELQVADVLVSFIEDSALPGTGIEVSTFWSGFSDLVHGFGSENRALLDKRAEI
QSQIDDWHIAHRDQPHDHEAYSAFLREIGYLVEDGPAFEIDTANVDPEIASVPGPQLVVP
ITNARYALNAANARWGSLYDGFYGTDAMGSPAPKGGYDQGRGARVVARARVFLDEAFPIV
GTSHADARRYIVHKGALLVDDQPLVSPEKFIGHTGHAKAPDSIVLCNNGLHVKLVFDRTH
AIGGRDQAGLADVQMESAVSAIMDCEDSVACVDAEDKVVAYANWLGLMKGDLEDSFEKGG
KILTRRLNDDVTLTGPQEQDVVLKGRALMLVRNVGHLMTNPAILDRDGNEVFEGLMDAMI
TTLIAMHDLKRAGGNSLTGSVYVVKPKMHGPEEVAFADRTFTHVENVLGLPQYTVKLGIM
DEERRTSVNLKECIRAAKSRVAFINTGFLDRTGDEIHTSMEAGPFSRKDFIKRKAWIGAY
ENQNVDIGLECGLSGRAQIGKGMWAMPDLMAAMLEQKIEHPKSGANCAWVPSPTAATLHA
LHYHKVDVFAVQEKLRAGGRRAYVDTVLDIPLATYQKWTTEQVRREVENNAQGILGYVVR
WVDQGVGCSKVPDMNNVGLMEDRATCRISAQHIANWLHHGVVDAQDVMAALRKMAEVVDA
QNTSDPAYMPMAPGYDGIAFQAACDLVFKGRVQPSGYTEPVLHARRLELKALAQD
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgaccggatttcagacaaaatgtgaactgcaggtcgctgatgtacttgtctctttcata
gaggacagcgcattgccgggtacgggcatagaggtgtcgaccttctggtccggattttct
gacctcgtgcatgggttcggctccgaaaaccgggccttgctggacaagcgcgcagaaatc
caatcacagatagatgactggcatattgcgcatcgcgaccaaccccacgatcatgaagcc
tattcggcctttctgcgggagatcggatatctggttgaggacggtcccgcctttgaaatc
gatacggcaaatgttgatcccgagattgccagcgttccgggtccacagcttgtggtgccc
attaccaatgcgcgctatgcgctcaatgcggccaatgcgcgttggggcagcttgtatgac
ggattttatggcaccgatgccatgggcagcccggctcctaagggtgggtatgatcagggg
cgtggcgcgcgggttgtagcacgtgcgcgggtgtttctggacgaggcatttccgattgtc
ggcaccagccatgcggatgcccggcggtatatcgtgcacaagggggccttgctggtggat
gatcaaccgcttgtcagcccggaaaaattcatcggacacacgggccatgccaaagcgccc
gacagcatcgtgctgtgcaacaacggcctgcatgtgaaactggtctttgaccgcacgcat
gcgattggcgggcgcgatcaggcaggccttgccgatgtgcagatggaaagtgcggtgtcc
gcgatcatggattgcgaagattctgtcgcatgcgtcgatgccgaggataaggtcgtggcc
tatgccaactggcttggtctgatgaagggagacctcgaggactcctttgaaaagggtggg
aagatactcacccggcgtctcaacgatgatgtgacgctgaccggtccgcaagagcaggac
gtcgtgctgaaaggccgggccttgatgttggtacgaaacgtcggtcatctgatgacgaac
cccgccattcttgatcgcgatggcaatgaggtctttgagggcctgatggacgctatgatc
accacgctgatcgcgatgcatgatctcaaacgggcgggcggcaattctctgaccgggtcc
gtctatgtagtcaaacccaagatgcatggacccgaagaggtcgcctttgcggatcgcacg
ttcacgcatgtcgagaacgtgcttggcctgccgcaatacacggtcaagctgggcattatg
gatgaagagcggcgtacgtccgtgaacctgaaagaatgcattcgcgccgccaaatcgcgg
gtcgccttcatcaataccgggttccttgaccggacgggcgatgaaatccacacctcgatg
gaggcagggcccttcagccgcaaggacttcatcaagcgcaaggcgtggattggcgcctat
gaaaaccagaatgtcgatatcgggctggaatgtggtctttcggggcgcgcgcagatcggc
aagggaatgtgggccatgccggaccttatggccgcgatgctggagcaaaagatcgaacac
cccaaatcgggtgcaaactgtgcctgggtgccaagcccgacagcggccacgctgcatgcg
ttgcactatcacaaggtcgacgtcttcgcagtgcaggaaaaactgcgcgcgggcggtcgg
cgagcctatgtcgacacggtgctggatatcccgctggcaacctatcagaaatggacgacc
gagcaggtgcgccgcgaggttgaaaacaacgcgcagggcattctgggctatgtggtgcgc
tgggtcgatcagggggtgggctgttctaaagtgcctgatatgaacaacgttggtctgatg
gaagaccgcgcaacctgccgcatatcggcgcaacatattgcgaactggttgcaccacggt
gtggtcgatgcgcaggatgtcatggccgcgctgcgcaagatggcagaggtggtggacgcg
cagaacaccagcgaccctgcgtacatgcccatggcaccgggctatgatggcattgcgttt
caggccgcctgtgatctggtgttcaagggccgtgttcagccctcgggctacacagagcct
gtcttgcatgcacgccggctggagttgaaggctcttgctcaggactaa

DBGET integrated database retrieval system