KEGG   Roseobacter litoralis: RLO149_c026970Help
Entry
RLO149_c026970    CDS       T01572                                 

Gene name
tdk
Definition
thymidine kinase Tdk (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
rli  Roseobacter litoralis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RLO149_c026970 (tdk)
Enzymes [BR:rli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     RLO149_c026970 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2759770..2760351
Genome map
AA seq 193 aa AA seqDB search
MAKLYFNYSTMNAGKSTVLLQAAHNYKERGMVPFLITAQVDDRAGDGRIASRIGIGEPAD
TFTTGENLFSKIANRLKEGPVACVFVDEAQFLSAEQVWQLARAVDDLGVPVMCFGLRVDF
RGELFPGSATLLALADEMREVRTICHCGKKASMVIRKDENGTVLRDGAQIQVGGNETYVS
LCRRHWREAVGDR
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctttacttcaactactccacaatgaacgccggaaaatcgaccgttctgtta
caggccgcgcataactacaaagagcgcggcatggtgccattcctgatcaccgcacaagtg
gatgaccgggcaggcgacggtcgtattgcctcgcgcattggaatcggtgagccagcggac
accttcacgacaggagagaaccttttctccaaaatcgcaaaccggctgaaagaaggcccg
gttgcgtgcgtgtttgtggatgaggcgcaatttctcagcgcagaacaggtgtggcaactg
gcgcgcgcggtggatgatctgggcgtgcccgtcatgtgctttgggctgcgggtggatttt
cgcggcgaactgtttccagggtccgcaacactgctggcgctggctgatgaaatgcgcgag
gtgcgcaccatttgtcattgcggcaagaaagccagcatggtcatccgcaaagacgaaaac
gggaccgttctgcgcgatggcgcgcaaatacaggtcggcggcaacgagacatatgtatca
ctgtgccgccgccattggcgcgaagctgtcggcgaccgctaa

DBGET integrated database retrieval system