KEGG   Roseobacter litoralis Och 149: RLO149_c029010Help
Entry
RLO149_c029010    CDS       T01572                                 

Definition
lysophospholipase L2-like protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
rli  Roseobacter litoralis Och 149
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:rli00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2959654..2960601
Genome map
AA seq 315 aa AA seqDB search
MTLHPAPYYGDIAHGPEDAAAYWVTTSDDVRIRVGHWPIHAAKGTVLIFPGRTEYIEKYG
QIAKALGERGLASISVDWRGQGLADRLLDDPVIGHVDHFSDYQKDVAAMMRAARELELPR
PFFLLAHSMGGAIGLRAAMEGLAVRAVVFSGPMWGIKIAPHLKPAAWVLSHTMPRIGQGH
RLPPGTKMEHHVLTDGFEDNVLTRDPAQFEIMRQQLLTHPELTLGGPSYVWLREALLETR
HLSSRAAPNVPCLTLMGSNERIVDISAIHTRMQSWKRGHLEIVPDAEHEVLMEGPQVTTG
LFDQMVDLFLEEGGV
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgacacttcatcccgccccgtattatggcgacatagcgcatggccccgaagacgctgcg
gcgtattgggtgacgacatctgatgatgtccgcatccgtgtgggtcattggcccatacac
gcggccaagggcactgtgctgatttttccggggcggactgaatacatcgaaaaatacgga
cagattgccaaggcgcttggcgaacgcggtctggcgagcatttcggtagactggcgtgga
cagggcctcgcggaccggctgctcgatgatccggtaattggtcacgtggatcatttttcc
gattaccagaaggatgtcgccgccatgatgcgggcggcacgcgaactggaattgccgcgt
ccatttttcctgcttgcgcattctatgggcggagcgattgggttgcgcgccgcgatggaa
gggctggccgtgcgtgctgtcgttttcagcggcccgatgtggggcatcaagatcgcgccc
cacctcaagcctgccgcgtgggttctcagccataccatgccacgcatcggtcagggccac
aggctgccaccggggacaaagatggaacaccacgtgctgaccgacgggttcgaagacaac
gtgctgacccgcgatccggcgcaatttgaaatcatgcgacagcagcttttaacccacccc
gaactgacactgggtggcccaagttacgtctggctgcgtgaggcactgctggaaacgcgc
catttgtcgagccgggctgcgccgaacgtgccctgccttaccttgatgggcagcaacgaa
cgcatcgtcgacatttctgccattcacacccggatgcaaagttggaagcgcggacatctt
gagatcgtaccggatgccgagcatgaagttctcatggaaggcccgcaggtgaccaccgga
ttgtttgaccagatggttgacctgtttctggaagagggcggtgtttaa

DBGET integrated database retrieval system