KEGG   Roseobacter litoralis Och 149: RLO149_c029790Help
Entry
RLO149_c029790    CDS       T01572                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rli  Roseobacter litoralis Och 149
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3035758..3036411)
Genome map
AA seq 217 aa AA seqDB search
MADFLSRRTMMVDTQVRPSDVTKFPIIDAMLTIPREEFVPAAQREAAYMGENLQIGAGRV
ILEPRTLAKMLDALDVSVDELVLDVGSALGYSAAVIARMAEAVVAVEEDEALASEAQEAL
SMAGVDNVIVHVAPLAEGAAQHGPYDVVIVQGGVVEFPQALADQLNEGGRAACIFMKGAL
GEVRIGHKQNGKITWRMAFNAGAPILPGFARAAEFQF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggccgactttttatcacgacgcacgatgatggtggacacgcaagtgcgcccctctgat
gtgacaaagttcccgataatcgacgcgatgctgacgataccgagggaggaattcgttcct
gccgctcagcgcgaggcggcatatatgggggaaaacctgcaaatcggtgccggacgtgtc
atcctcgagccgagaacgctggccaagatgctggatgcgcttgatgtgtcagtggacgaa
ctcgtgttggatgtcgggtcagcgttgggctattcggcggccgtcatcgcgcgtatggcc
gaagcggtcgtggcggtcgaagaagacgaagcgctggcgtcagaggcgcaggaagcgctg
agcatggcaggcgttgataatgtcattgtgcatgttgcgccgcttgcggaaggtgcggca
cagcacggtccgtatgatgttgtcatcgttcagggcggcgtcgtggagtttcctcaggca
ttggcggatcaactgaatgagggtgggcgcgcggcgtgcattttcatgaagggtgctctt
ggtgaagtgcgcattggtcacaagcaaaatggcaagatcacctggcggatggcttttaac
gcaggtgcgccgatacttccgggctttgcaagggctgcggaatttcagttttag

DBGET integrated database retrieval system