KEGG   Roseobacter litoralis: RLO149_c030810Help
Entry
RLO149_c030810    CDS       T01572                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor subunit SdhD
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rli  Roseobacter litoralis
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RLO149_c030810 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RLO149_c030810 (sdhD)
   00650 Butanoate metabolism
    RLO149_c030810 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    RLO149_c030810 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3140394..3140765)
Genome map
AA seq 123 aa AA seqDB search
MSYLTDRKRAVGLGSAKSGTEHHWSMTVSSGALLILIPLFVFTFGPMLGASYEEVTAYFA
RPFPAVIAGLTIIVTFKHFAGGVQALLEDYVHGVAQKVAIVAMTCVSYAAMGFGLYAIVR
LAL
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgagctatctaaccgaccgaaagcgcgctgtgggccttggatctgccaagtccgggacg
gaacaccactggtcgatgacggtcagttctggtgcgctgcttattctgatcccgctgttc
gtctttacctttggcccgatgctgggcgcgtcatacgaagaggttacggcctatttcgcc
cgcccgttcccggcggtaattgccggtttgacgatcattgtaacgtttaagcactttgcg
gggggcgttcaggcgctacttgaggactacgtgcacggtgtggcgcaaaaagtggcgatc
gtggcgatgacatgcgtcagctatgcggccatgggttttggcctctatgcgattgttcgc
ctcgcactgtaa

DBGET integrated database retrieval system