KEGG   Roseobacter litoralis: RLO149_c031000Help
Entry
RLO149_c031000    CDS       T01572                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rli  Roseobacter litoralis
Pathway
rli00020  Citrate cycle (TCA cycle)
rli00310  Lysine degradation
rli01100  Metabolic pathways
rli01110  Biosynthesis of secondary metabolites
rli01120  Microbial metabolism in diverse environments
rli01130  Biosynthesis of antibiotics
rli01200  Carbon metabolism
Module
rli_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rli_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RLO149_c031000 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    RLO149_c031000 (sucB)
Enzymes [BR:rli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RLO149_c031000 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H HlyD_D23 RnfC_N Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AEI95056
UniProt: F7ZIZ6
Position
3156938..3158434
Genome map
AA seq 498 aa AA seqDB search
MTTEVRVPTLGESVTEATVATWFKKPGEAVAVDEMLCELETDKVTVEVPSPIAGTLGEIV
AAEGDTVGVNALLATIAEGVAAAAPAEKPAAAAPAAASASVDVMVPTLGESVTEATVSTW
FKAVGDSVAQDEMLCELETDKVSVEVPAPASGVLTEILAAEGATIQAGGKLALLSSGDGA
SAAPASAPAPAAAAAPASGSKDVEDAPSAKKAMAEAGISPDQVTGSGRDGRIMKEDVSSA
IAAANAAPAPAAAPAAPRAPVSADDASREERVKMTRLRQTIAKRLKDSQNTAAMLTTYNE
VDMTEVMALRNEYKDLFFKKHGVKLGFMSFFTKACCHALREVPEVNAEIDGTDIVYKNFV
HMGIAAGTPTGLVVPVIRDADAMSFHAIEQAIAEKGARARDGKLSMAEMQGGTFTISNGG
VYGSLMSSPILNPPQSGILGMHKIQDRPMAIGGQVVIRPMMYLALSYDHRIVDGKGAVTF
LVRVKEALEDPRRLLMDL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaccactgaagtacgcgtaccgacattgggcgaatccgtgaccgaggccaccgtggcc
acctggttcaagaaacccggtgaggctgtggccgtggacgaaatgctctgcgagttggaa
acggataaggtcacggtcgaagtgccctctcccatcgctggcacattgggtgaaatcgtt
gccgccgaaggcgataccgtcggcgtaaatgcgttgctcgcgacaatagccgaaggggtc
gcagcggctgcccccgccgaaaaacccgccgccgccgcaccggctgccgcatccgcgtct
gtcgatgtcatggtccccacattgggcgaatccgtaaccgaggctaccgtcagcacatgg
ttcaaggccgtcggcgacagcgtggcgcaggacgaaatgctgtgcgaattggaaaccgac
aaggtcagtgtcgaggtccccgcacctgcctcaggtgtcttgacggaaatactggccgct
gaaggcgcaaccattcaggctggtggcaaactggcgctcctgtcttcgggcgacggtgca
tccgccgccccggcgtcagcacccgcccctgccgccgcagcggcccctgcaagtggcagc
aaggacgtcgaagacgcgccttccgccaaaaaagcaatggcggaggccggaataagtcct
gatcaggtgacaggctccgggcgcgacgggcgtattatgaaagaagacgtcagcagcgcc
atagctgcggccaatgcggcccctgcccccgcagcggcccccgcggccccgcgcgcgcct
gtctctgcggatgacgccagccgcgaagaacgggtcaagatgacgcgcctgcgccagacc
atcgccaagcgcctcaaggacagccagaacaccgctgccatgctcaccacctacaacgag
gtcgacatgaccgaggtgatggccctgcgcaacgagtacaaagacctgttctttaaaaag
catggtgtcaaactgggctttatgtctttctttacaaaggcctgctgccacgccctgcgc
gaggtgcccgaggtcaacgcagagattgatggcacggatatcgtctacaagaacttcgtc
catatggggatcgcggcgggcacgcccacgggccttgtggtgccggtcattcgcgatgcg
gacgccatgtcgttccatgccatcgaacaggcgattgccgagaagggcgcgcgcgcacgc
gacggcaagctgtcgatggccgaaatgcaaggcgggacgtttacgatctcgaacggcggt
gtttacggctcgctgatgagttccccgatcctgaacccaccgcagtcgggcatcctcggc
atgcataaaattcaggaccgcccgatggccatcggcggccaggtggtgatccgcccgatg
atgtatctggcgctcagctatgaccaccggatcgtggatggcaaaggcgctgtgaccttc
ctcgtgcgcgtgaaagaagcgctggaagacccacggcgtttgttaatggatttataa

DBGET integrated database retrieval system