KEGG   Roseobacter litoralis Och 149: RLO149_c031380Help
Entry
RLO149_c031380    CDS       T01572                                 

Gene name
nirS
Definition
nitrite reductase NirS (EC:1.7.2.1)
Orthology
K15864  
nitrite reductase (NO-forming) / hydroxylamine reductase [EC:1.7.2.1 1.7.99.1]
Organism
rli  Roseobacter litoralis Och 149
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:rli00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3218910..3220652)
Genome map
AA seq 580 aa AA seqDB search
MSLSILTRSVAVSALLSLSATLALAQDKPADHGDDASAAYQPSLTTLGQIQVEIPGRKPG
DPVMTPSEYQDSNTIYFQRCAGCHGVLRKGATGKALTTDITRPNGFEYLRDFITYGSPAG
MPNWGTSGDMTEEQVDAMARYLLLEPAVPPEWGMAEMRDSWKVIVAPEDRPTEKMNDIDI
DNLFSVTLRDAGEIALIDGASYEIKTIIETGYAVHISRISASGRYLFVIGRDAKVVMIDL
WMETPGPVAEIKVGSEARSVETSKFKGYEDKYAIAGAYWPPQFVIMDGDTLEPLRIKSTR
GMTYDEQDFHPEPRVAAILGSHYKPEFLVNVKETGKIMMVDYSDMDALKITEINAERFLH
DGGLDSTQRYFLTAANARGKIVVIDTKESKKVAVIETEGETPHPGRGANINHPTYGPVWA
TSHLGDDTVALIGTDPEGNPDHAWKMVQQLYALGGGSLFVKSHPTSNHLYVDATLNPDAE
TSGSVAVFKIDELGQEEPEYTVLPLVEWAGIAEGQPRVVQGEFNQAGNEIWFSIWNAADL
ESAIVVVDDKTLEMKHVIKDERLVTPTGKFNVFNTRADVY
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgtccctatccattctcacacgttctgttgctgtcagcgcgctgttgtcgctgtccgcc
acattggcgctcgcacaggataagcctgcggatcacggcgatgatgcgtccgctgcctac
cagccgtccctgacaacactgggtcagattcaggtggaaattcctggccgcaagcccggt
gatccggtcatgacgcccagcgaatatcaggactcgaacacaatttattttcagcggtgt
gcgggctgccacggggttctgcgcaaaggcgcgacgggcaaggcgctgaccacagacatc
acgcgtccgaacgggttcgaatacctgcgcgatttcatcacctatggctcgcctgcgggc
atgcccaactggggcacctcgggcgacatgaccgaagagcaggttgatgccatggcgcgt
tatctgctgctggaaccggccgtaccgccggagtggggcatggccgagatgcgcgacagc
tggaaagtgatcgtcgcccccgaagaccggcccactgaaaagatgaacgacatcgacatc
gacaacctgttctcggtcacgctgcgggatgcgggtgagatcgccctgattgacggcgcg
agctacgagatcaagacgatcatcgaaaccggctatgctgttcacatcagccggatttcc
gcatcaggtcgctatcttttcgtgatcggtcgggacgccaaggtcgttatgatcgatctg
tggatggaaacacccggccccgtggccgagatcaaagtcggatcagaggcgcggtcggtc
gagacctcgaaattcaagggctatgaggacaaatacgccatcgccggtgcctactggccg
ccacagttcgtcatcatggacggtgacacgctggagccactgcgcatcaaatccacgcgc
ggcatgacctatgacgagcaggatttccaccccgaaccccgcgtcgcggcgatcctcgga
tcacactataagcccgagttccttgtgaacgtgaaagaaaccggcaagatcatgatggtg
gattattccgacatggacgcgctgaaaatcaccgagatcaacgcggaacgcttcctgcat
gatggcggtctggacagcacgcagcgttactttctgacggcggcgaacgcccgtggcaag
atcgtcgtgatcgataccaaggaaagcaagaaggtcgccgtaatcgagaccgaaggcgag
acaccgcaccccggtcgtggcgccaatatcaaccacccgacctatggacccgtttgggcc
acctcgcaccttggggatgacacggttgcattgatcgggacggacccagaaggcaacccg
gatcacgcctggaaaatggtgcagcagctttatgccctgggtggcgggtcgctgttcgtg
aaatcgcaccccacgtcaaatcacctctatgtggatgcgacgctgaacccggatgcggaa
acgtccggctcggttgcggtcttcaagatcgacgagttgggtcaggaagagccggagtac
accgttctgccgctggttgaatgggccggtattgccgaaggccagccgcgtgttgtgcag
ggcgaattcaatcaggcgggcaatgagatctggttctcaatctggaacgccgctgatctg
gaatcggccatcgttgtggtcgacgacaagaccctcgaaatgaagcacgtcatcaaggac
gaacgtctggtcacaccgaccggcaagttcaacgtcttcaacacccgcgcggatgtctac
tga

DBGET integrated database retrieval system