KEGG   Roseobacter litoralis: RLO149_c031440Help
Entry
RLO149_c031440    CDS       T01572                                 

Gene name
norD
Definition
protein NorD
Orthology
K02448  
nitric oxide reductase NorD protein
Organism
rli  Roseobacter litoralis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3225882..3227786
Genome map
AA seq 634 aa AA seqDB search
MSDALEPWEPEETIGKIWHRWASHFDAPEPTPPQAAVHLEDETARLSVLFRGLGGDPSVE
IRPVMNAASHHRLSWRRKLGTWVEHAPQASFDGGILRLPITLDLFADSALNRGLYTWLAV
CAAGVRAIPATPDDPLAADLAYLHAGQEMALRALTQYPGFKTLFVALKDAHLAARPRTAL
PRAEASAEMLARYVLGEGDAPEAPPGAAPRKYRSLRPVPLWPRLMPGGPSAFQTIDDIPE
DAETGTEETLETTKKGKRKAADQTERRDSLILHKFEAILSFTDFLNLNRRTDDDDLEAAK
KAMDDLEELSLTDISKAPASKFKLNLDLAPSDVNREAISGKHTYDEWDVQSHSYLPDHCR
VFASETEPADAPAPQDAAAKRRIRNVRRQFETFRPRPVTLKSQPDGDTLDLSAVIRARAD
IAATGSAHDRLWCQTRPSSRNLAVSILIDTSRSTESAVTGRAVIDIEREALTALAWGLHA
CGDPLAIHAFSSLRRNRVYVERCKDFTEPMSREVECKLASLRPGFYTRLGAAIRHVSADL
QTTPQSAKLLLVLTDGKPNDIDHYEGRHGIEDTRMAVREARMRGQSVFGITVDPKGQSWF
PRLFGPGGYAVIAQPEHLITTLPALYRQLVGDGG
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacgcgttggaaccttgggagccggaagaaaccatcggcaagatctggcaccgc
tgggccagccatttcgacgcgcccgaacccacacccccgcaggcggctgtgcatctggaa
gatgaaaccgcccgcctgtcggtgctgtttcgggggttgggcggtgatccatccgtcgaa
atccgccccgtcatgaacgcggccagccatcaccggctgagctggcggcgcaagctgggc
acctgggtcgagcacgcgccccaggccagctttgacggcggtatcctgcgcctgccgatt
accctcgatctgtttgctgatagcgcattgaaccgcggcctttatacgtggttggcggtc
tgcgctgccggtgtgcgcgccatccctgcgacaccggatgatccgctggccgctgatctg
gcctatctgcatgcagggcaggaaatggccctgcgcgcgctgacgcaataccccggtttc
aagacactgttcgtggctctgaaagacgcgcatctggccgcccgcccccgcaccgccctg
ccccgcgcagaggccagcgctgaaatgctggcgcgctatgttctgggtgagggcgacgcc
cccgaagcgccaccgggggccgccccgcgcaagtatcgctccttgcgccccgtgccgcta
tggccccgactgatgcccggtggtcccagtgcttttcagaccatcgatgacatccccgaa
gacgccgaaacaggcaccgaggaaacgctggaaacgaccaaaaagggcaaacgcaaagcc
gccgatcagaccgagcggcgcgacagcctgatcctgcataaattcgaagcgatcctgagt
tttaccgatttcctgaacctgaaccgccgcaccgacgacgatgatctggaggcggcgaaa
aaggccatggatgaccttgaggaactctctctcaccgatatctccaaagcgcctgccagc
aaattcaagctgaacctcgatctggccccgtctgatgtgaaccgcgaggcgatctcgggc
aaacacacctatgacgaatgggatgtgcaaagccacagctacctgcccgatcactgccgg
gtctttgcctcggaaaccgaacccgccgatgcccctgccccgcaggatgccgccgccaaa
cgccgcatccgcaacgtgcgccgtcagttcgaaacctttcgcccgcgccccgtcacgttg
aaatcgcagcccgatggggacacgctggatttgtccgccgtgatccgcgcgcgcgccgac
attgccgcgaccgggtcagcccatgatcggctctggtgtcagacgcggccctcttcgcgc
aatctggcggtatccatcctgatcgacacctcgcgcagcaccgaaagtgctgtgaccggc
cgtgctgtgatcgacatcgaacgcgaggcgctgaccgcgctggcctggggtttgcatgcc
tgcggtgatccgctggcgatccacgcgttttcgtcattgcgccgcaaccgcgtctatgtg
gagcggtgcaaggatttcaccgaaccgatgagccgcgaggtcgaatgcaagctggccagc
ctgcgccccgggttttacacccgtctgggggccgcgatccggcatgtatcggcggacctg
caaaccacaccgcaatcggccaagctgttgctggtgctgacggacggcaaacccaacgac
atcgaccactacgaagggcgtcacggcatcgaagacacccgcatggccgtgcgtgaggcg
cggatgcggggccagtccgtctttggcatcacggttgatccaaaagggcaaagctggttt
ccccggcttttcgggccgggcggttatgcggtcatcgcgcaacccgaacatctgatcacc
accctgcccgcgctttaccgccaactcgtcggggatggtgggtga

DBGET integrated database retrieval system