KEGG   Roseobacter litoralis Och 149: RLO149_c031550Help
Entry
RLO149_c031550    CDS       T01572                                 

Gene name
nosZ
Definition
nitrous-oxide reductase NosZ (EC:1.7.2.4)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
rli  Roseobacter litoralis Och 149
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:rli00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3235204..3237117)
Genome map
AA seq 637 aa AA seqDB search
MSEEERKAQMRLNRRQLMGATAGGAAFAAAGGAGLLGSAGKANAAEGAFNLAPGELDEYY
GFWSSGQSGEIRILGFPSMRELMRIPVFNRCSATGWGQTNESLQVLTEGLLPETKEMLAK
RGMKTYDNGDLHHPHMSFTDGTYDGRYIFANDKANTRVARIRCDIMKCDKIIEIPNAQDI
HGMRPQKYPRTGYVFANGEHEVPLVNDGQILDEPDQYVNIFTAIDGDEMKVAWQVIVSGN
LDNCDADYQGKYAFATSYNSEMGMNLAEMTANETDHCVVFNIAAIEAAVEAGEGQILNGV
RVLDGRKAANSQYTRYIPIPNSPHGCNAAPDKQHIVINGKLSPTVSVIDVTLVDAVFEGA
DPRSCIVAEPELGLGPLHTAFDGKGNCFTTLFLDSQVAKWNMEKAIAAYNGEDVDPIVSK
VDVHYQPGHNSTSMGETSEADGKWLISMNKFSKDRFLNTGPLKPENEQLIDISSGEMKVV
HDGPTFAEPHDSIIVHASKVNPVNIYSRDDPGWEAARQQAAADGVDLEDGHPEPIRDGNK
VRVYMYSIAPEFSLEKFTVQQGDEVTVYVTNLDDIDDVTHGFCLSNHGIAMEVGPQQTAS
ITFTADRPGVHWFYCNWFCHALHMEMRGRMFVEPRAT
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagaagaacgcaaagcgcaaatgcgcctgaaccggcgtcaactcatgggagca
accgcagggggcgctgcatttgcagccgccggcggtgccgggctgttgggcagtgcgggc
aaggcgaacgcggcagagggcgcattcaatctcgcccccggagagctggacgaatactac
ggtttctggtcgtcaggccaatcgggtgaaatccggattctcggctttccgtccatgcgc
gaactgatgcggatcccggtgttcaaccgctgctcggccaccggatggggccagaccaac
gagagccttcaggtgctaaccgaagggttgctgcccgagaccaaggaaatgctcgccaag
cgcggtatgaaaacctatgacaacggcgatttgcaccacccgcatatgagcttcaccgat
ggcacctacgacgggcgctatatctttgccaatgacaaggccaacacgcgggtcgcgcgc
atacgctgcgacatcatgaaatgcgacaagatcatcgagatccctaacgcgcaggacatc
cacggcatgcgccctcagaaatacccgcgcacgggctatgtctttgccaatggcgaacat
gaagtgccgctggtcaatgacgggcaaattctggatgaaccagatcagtatgtgaacatc
ttcaccgcgattgatggcgatgagatgaaagtcgcatggcaggtgatcgtgagcggcaac
cttgataactgcgatgcggattatcagggcaaatatgcctttgcgacctcgtataactcg
gaaatgggcatgaaccttgccgagatgaccgccaatgaaacggatcactgcgtcgtcttt
aacatcgcggccattgaagcggcggtagaagcgggtgaaggccagatactgaacggcgtg
cgggtgctcgacgggcgcaaggcggccaattcgcagtacacccgctatatccccatcccc
aacagcccgcatggctgtaacgcggcccccgacaaacagcacatcgtcatcaacggcaag
ctgtctccgaccgtgtccgtcattgacgtgacgctggtggatgcggtgtttgagggcgcg
gacccacggtcctgcatcgtcgcggagcctgaattgggccttggcccgctacacaccgcg
tttgatgggaagggcaactgtttcaccacgctcttcctcgacagtcaggtggccaagtgg
aacatggaaaaggcgattgcggcctataacggtgaagacgtcgatccgatcgtctccaag
gtcgatgtgcattaccagccggggcataactccacctccatgggcgaaacttcagaggcc
gacggcaaatggctgatttcgatgaacaagttttcgaaagacaggttcctcaataccggg
ccgctcaagcccgaaaacgagcagctcatcgatatctccagcggcgagatgaaggtggtg
catgacgggccgacctttgccgaaccgcatgacagtatcatcgtgcatgcctccaaggtg
aaccctgtcaacatctacagccgcgatgatccgggctgggaagcggcgcgccagcaggcg
gcagccgatggtgtcgatcttgaggacgggcatcccgaaccgatccgggatggtaataag
gtgcgggtctatatgtattccatcgcgccggaattcagccttgagaaattcaccgtgcag
cagggggatgaggtgaccgtctatgtcaccaaccttgatgacatcgatgatgtgacccac
ggcttctgcctgtccaaccacggtatcgccatggaagtggggccgcagcagactgcgtcc
atcaccttcactgcggatcgacccggtgtgcattggttctactgcaactggttctgccac
gcgctacatatggagatgcgcggccgcatgttcgtagagccgcgggcgacctga

DBGET integrated database retrieval system