KEGG   Roseobacter litoralis: RLO149_c031810Help
Entry
RLO149_c031810    CDS       T01572                                 

Gene name
soxE
Definition
flavocytochrome c cytochrome subunit SoxE
Orthology
K08738  
cytochrome c
Organism
rli  Roseobacter litoralis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RLO149_c031810 (soxE)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RLO149_c031810 (soxE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3269711..3270415)
Genome map
AA seq 234 aa AA seqDB search
MRVFLSSLAGLALALAAGGAMATGLGDADKGREVFRQCASCHKVGEGAENGIGPQLNGVF
GRTAGRVEGVKYSKNMIRMGNDGLIWTAQTLDAYIENPRALVSKTRMSFRGIKNEQERSD
LMAYLRRYSDDPGNIPEAEPTATGTDHDLDPVILAIQGDPEYGEYLASECKTCHQTSGAN
DGIPGITQWPTEDFVVAMHAYKRKLRPHPVMQMMAGRLSNDEIAALAAYFQDLE
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgttcctttcgtctttggccggtcttgcccttgctttggcagcggggggcgcg
atggccactggtttgggcgacgcggacaagggccgggaggtgttccgtcaatgcgcatcc
tgccacaaggtgggggagggcgccgaaaatggcatcggcccccagttgaacggggtgttt
ggccgcacggcagggcgtgtggagggggtgaaatactccaaaaacatgatccgcatgggc
aatgacggcctgatctggacggcgcaaacccttgatgcctatatcgagaacccgcgcgcc
ttggtctccaaaacacggatgagtttcaggggcatcaaaaacgaacaagagcgttccgac
ctgatggcgtatctgcgccgttactccgatgatccgggcaacattcccgaagccgagccg
accgcgacgggcaccgatcatgatctggatccggtgatcctcgccattcagggggatcct
gaatacggcgaatacctcgcgagtgagtgcaagacctgccaccagacaagtggcgcaaac
gatggtattcctggaattacgcaatggccgacggaggatttcgttgtggccatgcacgcc
tacaaacgcaagctcagaccccatcccgtcatgcagatgatggcggggcggttgtcaaat
gatgagatagcggcgctggccgcatattttcaggacctcgaataa

DBGET integrated database retrieval system