KEGG   Roseobacter litoralis Och 149: RLO149_c032620Help
Entry
RLO149_c032620    CDS       T01572                                 

Definition
dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rli  Roseobacter litoralis Och 149
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:rli01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rli00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:rli00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rli00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3356438..3357715)
Genome map
AA seq 425 aa AA seqDB search
MPVEVIMPKVDMDMASGTVSAWHVEIGATVVKGDPLFDIETDKAAMEVEAQNDGVLYHCV
PAGTEVAIGQPVAWLYDKDEEVGDAPVATPETVSENTTECSEPASDQAADVPNPLETQTA
RTDKTRATPRARTLVREAGIDITAVTGSGPRGRIQAKDVPQTSDPAFASPTIFVPETGLL
NITYRNGGTRNPIVLIHGFASDTKSWKQIEPFLADHPLIRIDLPCHGKSPNLRISSFSDL
VKTVRQTFDDLHLDGTQLIGHSLGGAVALAIADTRPSKVNSLCLIAPAGLGPDINGATLS
GIAKASRAESIAPWLKTLVQDDTLISEGYVRSVMATRTQSNMRAAQIALAGIVFPDGTQA
FDLKAALSRVEMPTRLIWGRRDKIIPWQHALTAPGNVAIHLFEDTGHLPHIERPEQIGKL
LATSI
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtcgaagtcatcatgccaaaggtcgatatggatatggccagcggaactgtgagc
gcatggcatgttgagatcggtgcgactgttgtcaagggagaccccctgtttgatatcgaa
accgacaaagccgcgatggaggtcgaggcccaaaacgatggtgtgctgtatcactgcgtt
cctgcggggaccgaagtggccataggccagccggttgcttggctttacgacaaagacgag
gaagtcggggatgcccccgttgctacgccggagactgtctccgaaaacacaactgaatgc
tctgaaccggcctctgatcaggccgctgacgtgccaaaccctttagagacgcaaaccgca
cggactgacaaaacccgtgcgaccccacgtgcccgcaccctcgtgcgcgaagccggtatc
gacattaccgcagtaacgggcagtggcccgcgcgggcgcatacaagccaaagacgtgccg
caaacgtctgaccctgcgttcgcatcaccgacaatattcgtgccggaaactgggctcctg
aacatcacttacagaaacgggggcacgcgaaaccccatcgttttgatccacggtttcgcc
agtgacactaaatcatggaagcagatcgaaccctttttagcggaccatcccctgatccgc
atcgatctgccctgccacggtaaatccccaaacctgcgtatcagcagcttctccgacctt
gtaaaaacggtgcgccaaacatttgatgatctgcatctggacggaacacaactcattggc
catagtcttggcggtgccgtcgcactggcgattgcagatacccggccgagtaaagttaac
tcgctttgcctaatcgcacctgctggccttggccctgatattaacggtgcgaccctgagc
ggcatcgcaaaggcatcccgtgcagaaagcattgcgccatggctgaaaacgctcgtccaa
gacgacacgctgatcagcgaaggttacgtccgttccgttatggcgacgcgcacacagtcc
aacatgcgggctgctcaaatcgctcttgcgggcattgttttcccggatgggactcaggct
tttgatctaaaagctgctctcagcagggttgaaatgcccacccgtctgatttggggtcgc
cgggataaaatcataccatggcagcacgcgctgacagcgcccggtaacgtcgcaatccac
ctttttgaggacactgggcacctacctcatatcgaacgtcccgaacagatcggcaaactg
ctggcaacgtcaatttga

DBGET integrated database retrieval system