KEGG   Roseobacter litoralis: RLO149_c032620Help
Entry
RLO149_c032620    CDS       T01572                                 

Definition
dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rli  Roseobacter litoralis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RLO149_c032620
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RLO149_c032620
   00020 Citrate cycle (TCA cycle)
    RLO149_c032620
   00620 Pyruvate metabolism
    RLO149_c032620
Enzymes [BR:rli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RLO149_c032620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3356438..3357715)
Genome map
AA seq 425 aa AA seqDB search
MPVEVIMPKVDMDMASGTVSAWHVEIGATVVKGDPLFDIETDKAAMEVEAQNDGVLYHCV
PAGTEVAIGQPVAWLYDKDEEVGDAPVATPETVSENTTECSEPASDQAADVPNPLETQTA
RTDKTRATPRARTLVREAGIDITAVTGSGPRGRIQAKDVPQTSDPAFASPTIFVPETGLL
NITYRNGGTRNPIVLIHGFASDTKSWKQIEPFLADHPLIRIDLPCHGKSPNLRISSFSDL
VKTVRQTFDDLHLDGTQLIGHSLGGAVALAIADTRPSKVNSLCLIAPAGLGPDINGATLS
GIAKASRAESIAPWLKTLVQDDTLISEGYVRSVMATRTQSNMRAAQIALAGIVFPDGTQA
FDLKAALSRVEMPTRLIWGRRDKIIPWQHALTAPGNVAIHLFEDTGHLPHIERPEQIGKL
LATSI
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtcgaagtcatcatgccaaaggtcgatatggatatggccagcggaactgtgagc
gcatggcatgttgagatcggtgcgactgttgtcaagggagaccccctgtttgatatcgaa
accgacaaagccgcgatggaggtcgaggcccaaaacgatggtgtgctgtatcactgcgtt
cctgcggggaccgaagtggccataggccagccggttgcttggctttacgacaaagacgag
gaagtcggggatgcccccgttgctacgccggagactgtctccgaaaacacaactgaatgc
tctgaaccggcctctgatcaggccgctgacgtgccaaaccctttagagacgcaaaccgca
cggactgacaaaacccgtgcgaccccacgtgcccgcaccctcgtgcgcgaagccggtatc
gacattaccgcagtaacgggcagtggcccgcgcgggcgcatacaagccaaagacgtgccg
caaacgtctgaccctgcgttcgcatcaccgacaatattcgtgccggaaactgggctcctg
aacatcacttacagaaacgggggcacgcgaaaccccatcgttttgatccacggtttcgcc
agtgacactaaatcatggaagcagatcgaaccctttttagcggaccatcccctgatccgc
atcgatctgccctgccacggtaaatccccaaacctgcgtatcagcagcttctccgacctt
gtaaaaacggtgcgccaaacatttgatgatctgcatctggacggaacacaactcattggc
catagtcttggcggtgccgtcgcactggcgattgcagatacccggccgagtaaagttaac
tcgctttgcctaatcgcacctgctggccttggccctgatattaacggtgcgaccctgagc
ggcatcgcaaaggcatcccgtgcagaaagcattgcgccatggctgaaaacgctcgtccaa
gacgacacgctgatcagcgaaggttacgtccgttccgttatggcgacgcgcacacagtcc
aacatgcgggctgctcaaatcgctcttgcgggcattgttttcccggatgggactcaggct
tttgatctaaaagctgctctcagcagggttgaaatgcccacccgtctgatttggggtcgc
cgggataaaatcataccatggcagcacgcgctgacagcgcccggtaacgtcgcaatccac
ctttttgaggacactgggcacctacctcatatcgaacgtcccgaacagatcggcaaactg
ctggcaacgtcaatttga

DBGET integrated database retrieval system