KEGG   Roseobacter litoralis: RLO149_c033710Help
Entry
RLO149_c033710    CDS       T01572                                 

Gene name
arcA
Definition
(GenBank) arginase ArcA
  KO
K01476  arginase [EC:3.5.3.1]
Organism
rli  Roseobacter litoralis
Pathway
rli00220  Arginine biosynthesis
rli00330  Arginine and proline metabolism
rli01100  Metabolic pathways
rli01110  Biosynthesis of secondary metabolites
rli01130  Biosynthesis of antibiotics
rli01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    RLO149_c033710 (arcA)
   00330 Arginine and proline metabolism
    RLO149_c033710 (arcA)
Enzymes [BR:rli01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     RLO149_c033710 (arcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AEI95312
UniProt: F7ZLA6
Position
3442875..3443801
Genome map
AA seq 308 aa AA seqDB search
MTKQKCILIGVPMDCGKRRQGCLMGPDAYRTAGLASTIRDLGYAAEDRGNVDPGTFAPDT
NDGKLHALNETIAWTRNLKEAAQAAMAEGLPIFMGGDHALSLGTVAGVAAHAARQDRPQF
VLWLDAHPDYHTPDTTDSGNLHGTPLGYLTGRGAFDGFPEVEVKVPTGNVAMIGLRSVDA
PEREAIQATDIQVADMRAIDENGIAAPLRKFLERVEAAGGMLHVSLDVDFLDPAIAPAVG
TTVPGGATMREAHLAMEMLHDSGLVTSLDLVELNPFLDERGRTASLMVELTASLLGRRVF
DRPTRSYS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacagaagtgcattttaatcggcgtgcccatggactgcggcaaacgccgccag
gggtgcctgatggggccggatgcgtaccgcacggcggggcttgcgtcgaccatccgtgat
ctgggctacgcggcggaggatcgcgggaatgtggaccccggtacattcgccccggacacg
aatgacggcaagctgcacgcgttgaacgaaacgatcgcctggaccaggaacctcaaggag
gcggctcaggctgccatggcagagggtttgccgattttcatgggcggggatcatgcgctc
tcactcggtacggttgccggggtcgcggcccacgccgcccggcaggaccgaccgcagttt
gttttgtggctcgatgcccatcccgattatcacacgcccgacaccacggattccggcaac
ctgcacggcacgccgcttggctatctgaccgggcgcggcgcctttgacggcttccccgag
gttgaggtcaaggtgcccaccggaaacgtcgccatgatcggcctgcgctctgttgatgcg
cccgaacgtgaggcgatacaggcgaccgatatacaggtcgccgatatgcgcgcgattgac
gaaaacggcattgcggcccctttgcgcaagtttctggaacgggtggaggcggcgggcggc
atgttgcatgtctcgctggatgtcgacttcctcgaccccgccatcgcgcccgccgttggc
accaccgtgccgggtggcgcgaccatgcgcgaggcgcatctggcgatggagatgctgcac
gacagcgggcttgtcacctcacttgatctcgtcgaactcaacccattccttgacgaacgc
ggtcgcactgcgtcgctcatggtcgaactcaccgcgtcgcttttgggccgccgtgtgttt
gaccgcccaacccgcagctattcctga

DBGET integrated database retrieval system