KEGG   Roseobacter litoralis: RLO149_c033710Help
Entry
RLO149_c033710    CDS       T01572                                 

Gene name
arcA
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
rli  Roseobacter litoralis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RLO149_c033710 (arcA)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RLO149_c033710 (arcA)
Enzymes [BR:rli01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     RLO149_c033710 (arcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3442875..3443801
Genome map
AA seq 308 aa AA seqDB search
MTKQKCILIGVPMDCGKRRQGCLMGPDAYRTAGLASTIRDLGYAAEDRGNVDPGTFAPDT
NDGKLHALNETIAWTRNLKEAAQAAMAEGLPIFMGGDHALSLGTVAGVAAHAARQDRPQF
VLWLDAHPDYHTPDTTDSGNLHGTPLGYLTGRGAFDGFPEVEVKVPTGNVAMIGLRSVDA
PEREAIQATDIQVADMRAIDENGIAAPLRKFLERVEAAGGMLHVSLDVDFLDPAIAPAVG
TTVPGGATMREAHLAMEMLHDSGLVTSLDLVELNPFLDERGRTASLMVELTASLLGRRVF
DRPTRSYS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacagaagtgcattttaatcggcgtgcccatggactgcggcaaacgccgccag
gggtgcctgatggggccggatgcgtaccgcacggcggggcttgcgtcgaccatccgtgat
ctgggctacgcggcggaggatcgcgggaatgtggaccccggtacattcgccccggacacg
aatgacggcaagctgcacgcgttgaacgaaacgatcgcctggaccaggaacctcaaggag
gcggctcaggctgccatggcagagggtttgccgattttcatgggcggggatcatgcgctc
tcactcggtacggttgccggggtcgcggcccacgccgcccggcaggaccgaccgcagttt
gttttgtggctcgatgcccatcccgattatcacacgcccgacaccacggattccggcaac
ctgcacggcacgccgcttggctatctgaccgggcgcggcgcctttgacggcttccccgag
gttgaggtcaaggtgcccaccggaaacgtcgccatgatcggcctgcgctctgttgatgcg
cccgaacgtgaggcgatacaggcgaccgatatacaggtcgccgatatgcgcgcgattgac
gaaaacggcattgcggcccctttgcgcaagtttctggaacgggtggaggcggcgggcggc
atgttgcatgtctcgctggatgtcgacttcctcgaccccgccatcgcgcccgccgttggc
accaccgtgccgggtggcgcgaccatgcgcgaggcgcatctggcgatggagatgctgcac
gacagcgggcttgtcacctcacttgatctcgtcgaactcaacccattccttgacgaacgc
ggtcgcactgcgtcgctcatggtcgaactcaccgcgtcgcttttgggccgccgtgtgttt
gaccgcccaacccgcagctattcctga

DBGET integrated database retrieval system