KEGG   Roseobacter litoralis: RLO149_c034280Help
Entry
RLO149_c034280    CDS       T01572                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rli  Roseobacter litoralis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RLO149_c034280
Enzymes [BR:rli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     RLO149_c034280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3489049..3489657)
Genome map
AA seq 202 aa AA seqDB search
MPQVTRQGKIGRKSPQLRSLALIAVGSNQGLRNGTPRDTVLNALKEFPVKVGAIRAFSRL
FRTAAFPAGSGPDFVNAAFTLETELDAADLLSHLHEIESLFKRTRTKRWEPRTLDLDLIA
MADQVLPDRGTYDHWAQLPLEQQMTKSPERLILPHPRLHERAFVLIPLADVAPDWRHPIT
GMSVNEMVEALPEDLRNEVREL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgccgcaagtgacaagacaggggaaaattggcagaaaatcgccacaattacggtcactt
gcactaattgccgtggggtcaaaccaagggttacgcaacggaaccccacgcgataccgta
ctgaatgcattgaaagaatttcccgttaaggttggagcgattcgggctttcagcaggctg
tttcgcacagctgccttcccggcgggatctggcccggattttgtcaatgcggccttcacc
cttgaaacggaactggatgcagccgaccttttgagccatcttcatgagattgaatcactg
ttcaagcgcacccggaccaagcgttgggagccgcgtactctggaccttgatctgatcgcg
atggcggatcaggttttgcctgatcgcgggacatatgatcactgggcgcagttgccgctt
gaacaacagatgaccaaatcaccggagcggttgatcctgccgcacccgcgcctgcatgag
cgggcttttgtcttgatcccactggccgatgttgcgccggattggcgtcatcccatcacg
ggaatgagcgtcaatgagatggttgaagcccttccggaagacctcagaaacgaagtccgt
gagctgtaa

DBGET integrated database retrieval system