KEGG   Roseobacter litoralis Och 149: RLO149_c035540Help
Entry
RLO149_c035540    CDS       T01572                                 

Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rli  Roseobacter litoralis Och 149
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:rli01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3602943..3603626)
Genome map
AA seq 227 aa AA seqDB search
MRKLIGCFVVCFPTWGAADGVVIAALGDSLTQGYGLVQEEGFVPQLQDWLDTQGIAARVI
NAGVSGDTTAGGLSRVAWTLTPEVDAMIVALGGNDLLRGIDPAESRRNITGILEAAAAQN
VEVLLVGMQAPGNFGPDFKAEFDAIYPELASEFGVLHAADFFEGLSVVGGDPASVRALMQ
PDGIHPNAGGVARIVEALGPDVAELVTQAGSRWAPLQKENGRRKAPE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagttaataggatgttttgtcgtttgttttccaacgtggggcgctgcggacggc
gttgtgattgcggctttgggcgatagcctgacgcaggggtatgggctggtgcaggaggag
ggtttcgtgccgcaattgcaggattggctggacacgcaaggcattgcggcgcgggtgatc
aacgcaggtgtctcgggcgacacaactgctggcgggttgtcgcgggtggcttggacactc
acaccggaggtggatgcgatgatcgtggccttgggaggcaatgatcttttgcgtgggatt
gacccggccgaaagccgtcgcaatatcactggaattctggaggctgcggcagcgcagaat
gtcgaggtgttgctggtgggaatgcaggccccgggtaattttggcccggatttcaaagct
gaatttgacgccatttatccggaacttgcgtcggaattcggcgttttacatgcggcggat
ttttttgaagggctgtccgttgtcgggggcgatccggcgagcgtcagggcattgatgcag
cctgacggaattcacccgaacgcaggtggagttgcgcgcatcgttgaggcgctcgggccg
gatgtggcggaactggtgacacaagccggatcgcgatgggccccgctgcaaaaagaaaac
gggcgccggaaagcgcccgaatga

DBGET integrated database retrieval system