KEGG   Roseobacter litoralis: RLO149_c037710Help
Entry
RLO149_c037710    CDS       T01572                                 

Definition
cytochrome c2
Orthology
K08738  
cytochrome c
Organism
rli  Roseobacter litoralis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RLO149_c037710
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RLO149_c037710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3816698..3817099)
Genome map
AA seq 133 aa AA seqDB search
MLKKILSVACLMALPAAGFADGHITGDAAAGEKVFRKCKACHAVGEGAENKIGPALNGVV
DAAVAGKPDFKYSDTLMAMASEGKTWTPEELAGFLEKPRNYAKGTKMAFAGLRKEEDRMN
VIAYLASFPAEGS
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagaaaattctatccgtcgcctgcctgatggcactgcctgccgccggctttgcg
gatggacatatcacgggcgatgcagcagcaggtgaaaaggtgtttcgcaagtgcaaagcc
tgccatgccgttggtgagggggctgagaacaagatcggccccgccctgaacggcgttgtt
gacgccgctgtcgcgggcaagcctgattttaaatattcggatacgctgatggcgatggcc
tctgagggtaaaacatggacacccgaggaacttgccggttttcttgaaaaaccacgcaac
tacgcaaaaggcaccaagatggcctttgccggattgcgcaaggaagaagaccgtatgaac
gtaattgcatatcttgcgtctttccctgcggaaggatcgtaa

DBGET integrated database retrieval system