KEGG   Roseobacter litoralis Och 149: RLO149_c041330Help
Entry
RLO149_c041330    CDS       T01572                                 

Definition
uroporophyrinogen-III synthase HemD-like protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rli  Roseobacter litoralis Och 149
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rli00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4178902..4179777)
Genome map
AA seq 291 aa AA seqDB search
MSRRMRFYAARRRLCHHNCFPAQELSECGPFKPPLHAFDLAGNTEARRKQCRGVAKAVQK
IPVILTRPKGSNSVFKAGIAPNVRDRLEFIRSPLLEITPIEQSADCSGAQHAIFTSANGV
KLAPNGNGRRAFCVGRKTTELAQSHGWDGVFAGATVTGLKEYVLTQQPQGEIHHYSGVFV
RGNVAKELSAAGLNVMNVPLYDQRLLPFSAEALAVLQAKTPVIVPLFSPRTAAHFGAMAP
AHPKLYIIAMSSAVADSLEEIAVSQLMVAQEPTAKSMAVCVEYLILNDSLG
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
gtgtctcgccggatgcgtttttacgcagcacggcggcggctgtgtcatcacaactgcttt
ccagcgcaagaactgtctgagtgcggcccattcaagcccccgttgcatgcctttgacttg
gcaggtaacaccgaagcgaggcgcaaacaatgccggggggtggcaaaggcggtgcaaaaa
attcctgtgatcctgacgcggccaaagggatcgaactccgtgtttaaagcgggcattgca
ccaaatgtccgagatcgtctggaattcattcgcagcccgcttcttgagatcacgccgata
gagcaaagcgctgactgctctggcgcgcagcatgcgattttcacctctgccaatggcgtg
aaacttgcgcctaacggaaacgggcggcgcgcgttttgcgtggggcggaaaacgaccgaa
ctggcgcaatcacatgggtgggatggtgtttttgcaggtgcgaccgtcacgggtttgaaa
gaatacgtgctgacccaacagccccaaggtgaaattcatcactattcaggggttttcgtg
cgtggaaacgtcgccaaagagctgtcggctgcgggtttgaatgtcatgaatgtgccgctc
tatgaccaacgtcttttacccttttcggcggaggcgttagcggttctgcaggcaaaaacg
cccgtcatagtgccgcttttttcgccacgtaccgctgcacattttggagcgatggcaccg
gctcatccgaagttgtatattattgcaatgagttcggcggtcgcggattctttagaagaa
atagcggtttcgcagctgatggttgcgcaggaacccaccgcaaaatccatggcagtttgt
gtggaataccttatactaaacgacagcttgggttga

DBGET integrated database retrieval system