KEGG   Roseobacter litoralis: RLO149_c041800Help
Entry
RLO149_c041800    CDS       T01572                                 

Definition
pfkB family carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rli  Roseobacter litoralis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RLO149_c041800
Enzymes [BR:rli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     RLO149_c041800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4228021..4228893
Genome map
AA seq 290 aa AA seqDB search
MAIYNLGSINADNVYRVPHLVGPGETLAATGFSQGLGGKGANMSVAAARAAARVFHIGAV
GPDGAWASERLLEYGVDTRHIARVDEPTGHANICVDEAGENDIVVFAGANRAITDAMIGA
ALAEASPGDSFVTQNETSGQAYGAETARKLGVRVIYAAAPFDAAAVNTVMEHLDLLVLNA
VEAAQLSAQTGSDIGDLPVSDVIVTMGSRGCKWLSRGAEPCLFPALDVTAVDTTGAGDTF
TGYLIAGLDRGMPMAQAIDLATRAAALMVTRVGTADVIPDLKEIQDMRLG
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggcgatctataacctcgggtcgattaacgccgacaacgtgtatcgcgtaccgcatctg
gtcggaccgggtgaaacgctggccgcgaccggtttttcccaaggcctgggcgggaagggc
gcgaatatgtccgtggcggccgcccgcgcggcggcgcgcgtgttccatatcggcgcggtt
ggtcccgacggtgcatgggcgtcggagcggctgttggaatatggtgttgatacgcgccac
atcgcacgggtggatgaacccacgggccacgcaaacatttgcgtcgatgaggcgggcgag
aatgacatcgttgtgttcgccggggcaaaccgcgcgattacggatgcgatgatcggtgcg
gctttggccgaggcctcgcccggcgacagctttgtcacccaaaatgaaaccagcggtcag
gcttacggcgcagagacagcgcgcaaactgggcgtgcgggtgatctacgccgcggccccg
tttgatgcggcggctgtcaatacggtgatggaacatcttgatctgctcgtgctcaacgca
gttgaagcggcgcaactgagcgcacaaacaggctctgacataggcgatttgccggtttct
gatgtcatcgtgaccatgggatcgcggggctgcaagtggctgtcgcgcggggccgaacct
tgcctgtttccggcgctggatgtcaccgccgttgatacgaccggcgcgggcgataccttc
actggttatctgattgcggggctggatcgtggtatgccgatggcgcaggcgattgatctt
gccacgcgagcggcggcattgatggtgacgcgggttggaacggcggatgtcattcccgat
ctgaaagaaattcaggatatgcggctgggttag

DBGET integrated database retrieval system