KEGG   Roseobacter litoralis: RLO149_c043880Help
Entry
RLO149_c043880    CDS       T01572                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase DapE
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rli  Roseobacter litoralis
Pathway
rli00300  Lysine biosynthesis
rli01100  Metabolic pathways
rli01120  Microbial metabolism in diverse environments
rli01230  Biosynthesis of amino acids
Module
rli_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    RLO149_c043880 (dapE)
Enzymes [BR:rli01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     RLO149_c043880 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AEI96280
UniProt: F7ZJ35
Position
complement(4435123..4436268)
Genome map
AA seq 381 aa AA seqDB search
MTAVDPVRLTADLVRCASVTPADEGALDILHDVLSDAGFDCAWADRGGIRNLFARWGSKG
HPKTFGFNGHTDVVPIGNADDWSMPPFGAEVKDGIMYGRGTTDMKSGVAAFAAAALDFVR
DTPPDGAIVLAITGDEEGDAIDGTTALLAYMAAQDEQMSACLVGEPTCPDRMGEMIKIGR
RGSMTAWITVTGKQGHAAYPHRACNPLPALMRLMDRLASHKLDEGTEFFDPSTLAIVTVD
TGNPATNVIPASCSGTVNIRFNDAHSGASLTEWIKTELSKIEAEFGVQTGLRIKISGESF
LTPPGPLSALVSKAVKAQTGIEPVLSTTGGTSDARFVKDHCPVVEFGLVGQSMHQVDEHV
KTDHIVELKAIYSRILTDYFA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctgttgatcctgttcgtctgaccgctgatctggtccgttgcgcatccgtgacg
cctgccgatgagggcgcgctggatatcctccacgacgtgctcagcgatgcggggtttgac
tgtgcatgggccgaccgcggcggcattcgcaacctcttcgcgcgctggggcagcaagggg
caccctaagacttttggctttaacgggcatacggatgttgtgccgattggcaatgcggat
gactggtccatgccgccttttggcgctgaggtcaaagatggcatcatgtacgggcgtggc
accacggatatgaaatcaggcgttgcggcttttgccgccgctgcgctggatttcgtgcgc
gacacgccccccgatggggcgattgtgctggccatcaccggggacgaagagggtgatgca
atcgacggcacgactgcgttgttggcctatatggcggcgcaggacgaacagatgagcgcc
tgtctcgtcggagagcccacatgcccggatcgcatgggcgagatgatcaagatcggacgc
cgtggatcaatgaccgcatggatcacagtgaccggcaagcaggggcatgccgcctacccc
caccgcgcatgcaacccgctgcccgcacttatgcgcctgatggaccggctggccagccat
aagctcgatgagggcaccgagttttttgacccctcgacgctggcaattgtcacggtggat
accggtaaccctgccacgaacgtcattcccgcaagttgctccggcacggtgaatatccgg
ttcaatgatgcacatagcggtgcatccctgaccgagtggatcaagacagaactgtccaag
atagaggctgaattcggggtccagaccggcctgcggatcaagatttcgggggagagtttt
ctgaccccgcccggccccctgtccgcgctcgtcagcaaggcggtgaaagcgcaaaccggt
atcgagccggtgctcagcaccacggggggcacatcagatgcgcgctttgtcaaagatcac
tgcccggtggttgagttcggtctggtcggtcaatccatgcatcaggtcgatgagcacgtc
aaaaccgatcacatcgtcgagctgaaagcgatctattcgagaatactcaccgactatttt
gcatga

DBGET integrated database retrieval system