KEGG   Roseobacter litoralis: RLO149_c044530Help
Entry
RLO149_c044530    CDS       T01572                                 

Gene name
phbA2
Definition
(GenBank) acetyl-CoA acetyltransferase PhaA
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rli  Roseobacter litoralis
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Module
Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RLO149_c044530 (phbA2)
   00630 Glyoxylate and dicarboxylate metabolism
    RLO149_c044530 (phbA2)
   00640 Propanoate metabolism
    RLO149_c044530 (phbA2)
   00650 Butanoate metabolism
    RLO149_c044530 (phbA2)
  Lipid metabolism
   00071 Fatty acid degradation
    RLO149_c044530 (phbA2)
   00072 Synthesis and degradation of ketone bodies
    RLO149_c044530 (phbA2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RLO149_c044530 (phbA2)
   00310 Lysine degradation
    RLO149_c044530 (phbA2)
   00380 Tryptophan metabolism
    RLO149_c044530 (phbA2)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RLO149_c044530 (phbA2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RLO149_c044530 (phbA2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RLO149_c044530 (phbA2)
Enzymes [BR:rli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RLO149_c044530 (phbA2)
Exosome [BR:rli04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RLO149_c044530 (phbA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4498532..4499710
Genome map
AA seq 392 aa AA seqDB search
MTKEIVILDGARTAIGTFGGALAATPPIELATVASAAALQRAGVEGAQIGHVAFGHVINT
EPKDMYLSRVAAMQAGVPDTVPAMNVNRLCGSGAQAIVSVIQSLMLGDADFALAGGAENM
SRSPFIIPQQRWGAKMGDVKTLDMMLGALNCPFGTGHMGVTAENVAAEHHISRAQQDGFA
LQSQQRASDAIAAGHFQSQITPVEVRVKRDMVAFEVDEHPKATTLEALSGLRAVFQKDGT
VTAGNASGINDGAAAVVLATAEAAEKAGLKPKARVLGYAHAGVRPEVMGIGPVPAVQNLL
ARTGLSVTDFDVVESNEAFAAQALAVSQELGLDNAKVNPNGGAIALGHPVGATGAIITLK
AMYELERIGGKRALITMCIGGGQGIALAIERL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagagatcgtaattctggacggcgcgcgcacggcaatcggtacgtttggtggc
gcattggccgcgacgccccccattgaactcgccaccgtggccagcgcggccgcattgcaa
cgggcaggcgttgagggggcgcagatcggacatgtcgcctttggtcatgtgatcaatacc
gaaccgaaggacatgtacctgagccgtgtggccgcgatgcaggcgggcgtgcctgatacg
gtcccggcgatgaacgtcaatcggctgtgcggctctggtgcgcaggcgattgtctcggtt
attcagtcgcttatgctgggtgacgcagacttcgcccttgcgggtggtgctgagaacatg
tcgcgttcgccctttatcatcccgcaacagcgctggggtgcaaaaatgggggacgttaaa
acgcttgatatgatgttgggcgcattgaactgcccgttcggcaccgggcatatgggtgtt
acggcggaaaacgtcgcggcagagcatcacatcagccgcgcccagcaggacggatttgcc
ttgcaaagccagcagcgggcgtctgatgctatcgcagcgggccattttcagtcccagatc
acgcccgtcgaggtccgcgtgaaacgggacatggtggcttttgaagtggatgagcacccc
aaggcgacaactcttgaggccttgtcggggctgcgcgccgtcttccagaaagacgggacc
gtgaccgcagggaatgccagcggcatcaatgatggtgctgcggcagttgttttggcaacc
gctgaggccgccgaaaaggccggattgaaaccaaaggcccgcgttctgggctatgcgcat
gcgggcgtgcggcccgaagtcatgggcatcggcccggtgcccgccgttcaaaacctattg
gcgcgcacgggcctgtcggtgacggattttgatgtggtcgaaagcaatgaggcctttgct
gcgcaggcgctggccgtcagtcaggaactgggcctcgacaatgcaaaggtaaacccgaat
ggcggcgcaattgcattgggtcatcctgttggggcgacaggggcgattatcactctcaag
gcgatgtacgaattggaacggatcggcggcaaacgcgcgttgatcaccatgtgcatcggc
ggtggtcagggcatcgccctcgcgattgagcggctgtaa

DBGET integrated database retrieval system