KEGG   Roseobacter litoralis Och 149: RLO149_p940040Help
Entry
RLO149_p940040    CDS       T01572                                 

Gene name
bchD
Definition
magnesium-chelatase BchD (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
rli  Roseobacter litoralis Och 149
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rli00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pRLO149_94:complement(3330..4988)
Genome map
AA seq 552 aa AA seqDB search
MSHDADSWDRATLALRLLTVENANLGGAVIRMRASPARDQVLAALQGLNLRKIHPTITDD
QLFGGLDLAATLENSQLVENRSFFHTKTNALLVMAERCGTELAAKLAQVMDRDAGHMLLA
LDEGAEADEHAPAALADRLALHIEPEGRMPEGWRPVPAGTGLIDPQKVTATAQDIKALAE
IAAVFGIDSLRAPLLALRVARAHAALHGRTTVTDADLNAAAELTYPHRATRVPQEPDAAE
EPPAPPDDTPEDDEAGDSDTLSLPEGDMLVEAVKALLPPDLLAGLVPVGTSRGTSGAGAG
QKRKGNRRGRPLPSRPGRLDGRARIDLVATLRAAAPWQPLRKQAVPAGTGLHIRPSDIRL
KRYQEQSDRLLIFTVDASGSAAMSRLNEAKGAVELLLAQAYAARDHVALIAFRGDGAELL
LPPTRSLVQTKRRLASLPGGGGTPLAAGLQQAALLAQQSRSKGLTPTVVVLTDGRANIAL
DGTPDRAAAQADSEQMAQLIQTQNIAALVIDMSKRPQEPLRALSARLGAPYLALPRADAE
RLTGAVSAALDS
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
gtgagccatgatgctgacagctgggaccgcgcgaccctcgcgctccggctgctgacggtt
gaaaacgcaaaccttggcggggccgttatccgcatgcgcgccagccccgcgcgggatcag
gtgctggccgcgctgcaggggctcaacctgcgcaaaatccaccccacaatcaccgatgac
caactgtttggggggcttgatctggctgcgacgcttgaaaactcgcaactcgttgaaaat
aggtcattttttcatacaaaaacgaatgccttacttgtcatggcagagcgctgcggcacc
gagcttgccgcgaaactggcgcaagttatggacagggatgcagggcacatgctgctcgcg
ctcgatgaaggggccgaagcggatgaacatgcgcccgcagcccttgcggaccgccttgcg
ctgcacatcgaacccgaagggcgtatgcctgagggatggcgacctgtccccgcggggaca
ggcttgatcgacccgcaaaaggtgacagccaccgcgcaggatatcaaggcgctggccgag
atcgccgcagtctttggtatcgacagtttgcgcgcgcctttattggcgctgcgggtggct
cgggcccatgcggcgctgcacggtcgaaccactgttaccgacgctgacctcaacgcggcg
gctgaactgacctatccgcaccgcgccacgcgcgtcccacaggaacccgacgcagccgaa
gagccccctgccccgcccgacgatacgccagaagatgatgaggctggcgacagcgacacc
ctgtcgctgcccgaaggcgacatgcttgtggaggcggtcaaagccctgctgccacccgac
ctgctggcgggtcttgtccccgtggggacatcacgcggcacaagcggcgcaggggccggg
caaaaacgcaaaggcaaccgtcgtggacgccccctgccctcccgtccgggccggctcgat
gggcgcgcgcgcattgatctcgtggcaacgctgcgtgcggccgccccgtggcaaccgttg
cgcaaacaggctgtccccgcggggacagggttgcacatcagaccctcggacatccggctg
aaacgctatcaggaacaatctgaccggttgctcattttcactgtcgatgcgtcagggtcg
gcagccatgtcacgtctgaacgaagccaaaggtgccgtcgaactgctgctcgcgcaggcc
tatgccgcacgcgatcatgtggcgctgatcgcctttcgtggggatggcgcggaattactg
ttaccgcccacgcgttctctggtgcaaacgaaacgccgtctggccagcttgcccggcggc
ggcggcaccccattggccgcaggcctgcaacaagccgctctgctggcccagcagagccgc
tcaaaagggctgaccccgacagttgtcgttttgacagacgggcgcgctaatattgcgctg
gatggcacgccagaccgggcagcagcgcaggccgattcagaacagatggcgcagcttatc
cagacccaaaatattgccgcattggtaattgatatgtccaaacgcccacaagagccgctc
agggccctgtcagcacgtctgggcgcgccgtaccttgctttgccccgcgcggacgcggag
cggctcacaggggccgtcagcgcggcgctggacagttag

DBGET integrated database retrieval system