KEGG   Roseobacter litoralis: RLO149_p940340Help
Entry
RLO149_p940340    CDS       T01572                                 

Definition
(GenBank) putative succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rli  Roseobacter litoralis
Pathway
rli00300  Lysine biosynthesis
rli01100  Metabolic pathways
rli01120  Microbial metabolism in diverse environments
rli01230  Biosynthesis of amino acids
Module
rli_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    RLO149_p940340
Enzymes [BR:rli01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     RLO149_p940340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 ECR1_N
Motif
Other DBs
NCBI-ProteinID: AEI96379
UniProt: F7ZM42
Position
pRLO149_94:complement(34169..35449)
Genome map
AA seq 426 aa AA seqDB search
MHTELAATIENRRNDLIALTQALIGIPTLNPPGREYHTICQFIASRLEARGFAIEMIRAR
GTPGDSDTYPRWNVVARHEGATQGECVHFNSHIDVVEVGQGWTHDPFAGTLQDGRIYGRG
ACDMKGGLAASIIAVEAFIDTYPDYAGAIEISGTADEESGGYGGVAYLAERGYFDPQRVQ
HVIIPEPLNKDRICLGHRGGWWAEIETHGEIAHGSMPFLGDCAVRHMGAVLSEFEDKLFP
AMALRRTDMPVVPDGARQSTMNINSIHGGQAEQDADFDGLPAHCVPDSCRIVIDRRFLLE
EPLDQVRAEVTGLLENLKQTRTDFEYTLTEINSVLPSMTDRDAPIVRVVAQAIEEVIGKA
PDYVASPGTYDQKHIDRIGKLKNCIAYGPGILELAHKPDEYVGVDDMIDSAQVMAQSLVT
LLTGKG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcacactgaacttgccgcaacgatagaaaacagacgaaacgacctgatcgccctcaca
caggcgctgatcggcattccgacgctgaacccgccgggccgtgagtatcacacgatctgc
cagtttatcgcgtcccgtcttgaggcgcgcggctttgccattgagatgatccgcgccagg
ggaacacccggcgacagtgacacatacccaaggtggaacgttgtagcccggcacgaaggg
gccacgcagggtgagtgcgtgcatttcaacagccatatcgatgtggtcgaggtggggcag
ggttggacccatgacccctttgccggcacgctgcaggatggtcggatatatggccgtggc
gcttgtgatatgaagggcgggcttgctgcgtcgatcatcgcggttgaagccttcatcgac
acctaccccgattacgccggtgccatcgaaatttcaggcacggcggatgaggaatcaggt
ggatatggcggtgtcgcctatcttgcagagcgggggtatttcgacccgcagcgtgtgcag
catgtgatcatcccggaacctttgaacaaggaccgcatctgccttgggcaccggggcggc
tggtgggcagagatcgaaacccatggtgaaattgcgcatggctccatgcctttcctgggc
gattgtgccgtgcgccatatgggtgcagtgctgtctgaattcgaagacaagctgttcccc
gccatggccctacgtcggaccgatatgcccgttgtgcccgatggcgcacggcaatccacg
atgaacatcaattcgatccatggcgggcaagccgagcaggatgccgattttgacgggctg
cccgcgcattgcgtaccggacagttgccgtatcgtgattgaccgccgtttcctgttggaa
gagccgctggatcaggtccgtgccgaagtcaccggcctgcttgaaaacctgaaacaaacg
cgcacggattttgagtatacgctgacggaaatcaattctgtgctgccctcgatgaccgac
cgggacgcgccgattgttcgcgtcgtggcacaggcgattgaagaggtgatcggcaaggcc
ccggactacgtggcctcccccggcacctatgatcagaaacacatcgaccggatcggcaag
ctgaaaaactgcatcgcctatgggccggggattcttgagcttgcgcataagccggatgaa
tatgtcggcgtcgatgacatgatcgacagcgcgcaggtgatggcgcaatcgctggtcacg
ctgttgacgggcaagggctag

DBGET integrated database retrieval system