KEGG   Roseobacter litoralis: RLO149_p940730Help
Entry
RLO149_p940730    CDS       T01572                                 

Gene name
bchH
Definition
magnesium-chelatase BchH (EC:6.6.1.1)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
rli  Roseobacter litoralis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RLO149_p940730 (bchH)
Enzymes [BR:rli01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     RLO149_p940730 (bchH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pRLO149_94:79215..82787
Genome map
AA seq 1190 aa AA seqDB search
MRDDMSINGQMPGYRVVVITLDSHAAGPAMRAAERLSADYPGLDVSIHAAAEWGETPGTF
EAAKEAIENGDIIIANLLFLEEHCARILPSLEARRPDCDAMIGVIADASIVKLTKMGSLD
MMAPKSGAMKLMKKLRGSSKPSSSTGADKMALLRRLPKILKFIPGKSQDLRAWFMSMQYW
LGGSDDNVEAMMRFLLNRYAKNTGWAKAPDAPAPIEYPDAGLYHPDLPTRITTDLSDLPT
PNGAAATVGLLMMRSYVLSSDTAHYDAVIRAFEARGIAVRAAFAGGLDGRPAIDAYFRDQ
NGPQIDAMVSLTGFSLVGGPAYNDNDAAIKVLKDLDVPYLAAHPLEFQTLDQWACSTQGL
GPIETTMLIALPELDGATNPTVFAGRHGTAGCHGCDHDCKMTSDHKAMAPCLERVDSLVE
KTIRMTTLRRKTNAEKNIGIVLFGFPPNAGAVGTAAYLSVFESLFNTLHRLRADGYDVEV
PETVDALRDKVLAGNAKQYGQEANVADHVSADTIVRTTPPLAEIEAVWGPAPGRIQSDGR
GVFILGAHFGKVFVGVQPAFGYEGDPMRLLFEKGFAPTHAFTTFYLWLRNTLKADAILHF
GMHGALEFMPGKQAGLGARDWPDRLIGEMPNIYLYASNNPSEASLAKRRSGAVTITHLTP
PLAASGLYKGLLDLKDSLTRWRAMEKDGAERDELQDLIAQQADAVDLGNISPDQLWLKLL
ETEDALIPDGLHIIGKPLSDAARAEYLSIMDHADEETRARVDALLQQETELDAICRALSA
HYIEPVPGGDLIRSTDILPTGRNIHAFDPFRMPTAFACRDGAKQAQLLLDTHDAVPRTVA
LVLWGSDNIKSDGGPIAQALALMGCVPRFDSFGRLAGADLISLEDLGRPRIDVIMTLSGI
FRDLLPLQTRMLAEAAQKCAMADEPIEMNFVRAHALAYVEKTGCDITEAALRVFSNAEGA
YGSNVNQLVDSSAFGDEDELADAYQARKSFAYGTDGKASSNAALLQSQLAEVDVAYQNLE
SVELGVTTVDHYFDTLGGIARAVKRAKGSEAAVYIGDQTRGAGKVRTLKEQVALETRSRS
LNPKFFEGLLKHGAEGVRQIEAQVTNTMGWSATTGQVDPWVYQRLSETFVLDEEMRQRLA
DLNPTASSRMANRLLEAHDRNYWSPDAETLAALQDAADALEDQLEGIAAQ
NT seq 3573 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgatgatatgagcataaacgggcagatgcccggatatcgcgtggtggttatcacg
ctggacagccatgcagcaggtcccgccatgcgcgcagcggaacgcctttctgcggattat
cccggccttgatgtttcgattcacgcagcggcggaatggggcgaaacgcccggcaccttt
gaagccgcgaaagaagcgatcgaaaacggcgatatcatcattgccaacctgcttttcctc
gaagagcattgtgcgcgcattctgcccagccttgaggcccgtcgccccgattgtgatgcg
atgatcggcgtgattgccgatgcctccatcgtcaagctgaccaagatggggtcgctcgat
atgatggcgccaaagtcgggcgcgatgaaactgatgaaaaagctgcgcggctcgtccaag
ccctccagctcaacaggcgcggacaagatggcgctgctgcgccgtttgccaaaaatcctg
aagttcattccgggcaaaagccaggacctgcgcgcctggttcatgagcatgcaatactgg
ctgggtggctcagacgacaatgtcgaagcgatgatgcgctttttgctcaaccgctacgcc
aaaaacaccggatgggccaaagcgcccgacgcacctgcgccaatcgaataccctgacgcg
ggcctctatcatcccgacctgccgacacggattacaacagatctgagcgacctgcccaca
cccaacggcgcagcagcaacggtcgggctgttgatgatgcggtcctatgtgctttcctcg
gacacggcgcattatgatgctgtcattcgcgctttcgaagcgcgcggtattgcggtgcgc
gccgcctttgccgggggccttgatggtcggcccgcaatcgatgcctatttccgtgatcaa
aacggtccgcagattgatgcgatggtctctctgaccgggttttcactggtcggtggccct
gcctataatgacaacgacgccgccatcaaagttctgaaagatcttgatgtcccctacctc
gccgcgcatccgctggaattccagacgctggatcaatgggcctgctcgacgcaagggctt
ggaccgatcgagacgaccatgctcatcgcgctgcccgaacttgatggcgcgaccaacccg
accgtttttgccggtcgccacggcacagcagggtgtcacggctgcgatcacgactgtaaa
atgacgtcagatcacaaggcgatggccccctgtctggagcgggtcgacagccttgttgaa
aagaccatccgcatgaccacattgcggcgcaaaaccaacgcggaaaagaacattgggatt
gttctgttcgggtttccacccaacgcgggggccgtcggcactgctgcctacctcagcgtt
tttgaaagccttttcaatacgttacaccgcctcagagcagatggatacgacgtagaggtt
cccgaaaccgtcgatgcgctgcgcgacaaggtgctggcgggcaacgccaagcaatacggt
caggaagccaatgtcgcagaccacgtgagcgctgacaccatcgtcagaacaacgccgcca
cttgccgaaatcgaagccgtctggggcccagcacccggacgcattcaatcggacgggcgc
ggtgtgtttatccttggtgcccatttcggcaaggtctttgtcggcgtgcaaccggccttc
ggatacgaaggtgacccgatgcggctcctgtttgaaaaagggttcgcgccaacccatgcc
ttcacgacgttttatctatggctgcgcaatacactgaaagcagacgcgatcctgcatttc
ggcatgcatggcgcgcttgaattcatgccgggcaaacaggcgggccttggggcgcgcgac
tggcccgaccgcctgattggcgagatgccgaacatctacctttatgcgtcgaacaacccc
tccgaagcgtccttggcaaaacgtcgttccggtgcggtcacgatcacccatctgacgccg
cctctggcggcctccgggctctacaaagggcttctggacctcaaggacagcctgacccgc
tggcgcgcgatggaaaaagacggggctgagcgggatgagttgcaagacctcatcgcccag
caagcggatgccgtggacttgggcaatatcagcccggatcagctttggctcaaactgctc
gaaaccgaagatgcgctgatcccggatggcctgcacatcattggcaaaccgctctccgac
gcggcacgcgcggaatacctcagcatcatggatcacgcagatgaagaaacccgcgcgcgg
gtggatgcgcttttgcaacaggaaaccgaacttgacgcgatctgccgcgccctgtctgca
cattacatcgaacctgtgccgggcggtgatctgatccgctcaacggatatcctgccgacc
gggcgtaatatccatgcctttgaccccttccgcatgccgacggcgtttgcctgtcgggat
ggcgcaaaacaagcgcaactgctgctggatacacatgatgcggtgccgcggactgtggcg
ctggtgctttggggcagcgacaacatcaaatccgacggtggcccgattgcacaggccttg
gccctgatgggatgcgtgccccgctttgacagttttgggcggctggctggtgcagatctg
atttccttggaagacctcggacgcccacgcattgacgtgatcatgaccctgtcaggtatt
ttccgcgacctcctgcccttgcaaacgcgcatgctcgctgaggccgcacagaaatgcgcg
atggcggatgagccgattgagatgaattttgtccgtgcacatgcgctggcctacgttgag
aaaaccggctgcgatatcactgaagccgcgttgcgtgtgttctcgaacgccgaaggtgct
tacggctcaaacgtcaaccagctggtggacagttccgcctttggcgacgaagacgaactt
gccgatgcctatcaggcccgcaaaagctttgcttatgggacagacggcaaggcgtcctcc
aatgccgcactgctgcagtcccaactggccgaggtcgatgtggcctatcagaacctcgaa
tctgttgagctgggcgtgaccacggtcgatcattattttgacacgctgggcgggatcgca
cgggcggtcaaacgcgccaaagggtccgaagccgccgtttacatcggggatcagacccgc
ggggccggcaaggtccgcaccctgaaagagcaggtcgctctggaaacccgcagccgcagc
ctcaacccgaaattctttgagggcctgctgaaacacggcgccgaaggcgtacgccagatc
gaagcgcaggtcaccaacacgatgggctggtccgccaccacaggtcaggttgatccgtgg
gtctatcagcgcctgtccgaaaccttcgtgctggatgaagagatgcgtcagcgtcttgct
gacctcaacccgaccgcatcaagccgcatggcaaaccgcctgcttgaagcacatgaccgt
aattactggagccccgacgcagaaacgctggccgccttacaggatgcagccgatgcgctt
gaggatcaactcgaagggatcgcagcacaatga

DBGET integrated database retrieval system