KEGG   Roseobacter litoralis: RLO149_p940840Help
Entry
RLO149_p940840    CDS       T01572                                 

Definition
cytochrome c-551 (precursor)
Orthology
K08738  
cytochrome c
Organism
rli  Roseobacter litoralis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RLO149_p940840
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RLO149_p940840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pRLO149_94:91456..91875
Genome map
AA seq 139 aa AA seqDB search
MTRTLAVVLAMTFSAAPVFAEGDIEAGEKAFNKCKSCHQIVSDAGDEIVKGGRTGPNLYG
VLGRQAGTTDFRYGDDLVAAGEAGLVWDAANFAEYVQDPRAFLRTYLDDSKAKSKMAYKL
RSGGEDIAAYLASVTGSSS
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgacacgaactttagcagtagtactcgcaatgacattctcggcagcaccggtatttgcc
gaaggtgacatcgaagcaggtgaaaaagcattcaacaagtgcaagtcttgccaccagatc
gtttccgatgctggtgatgaaatcgtcaaaggcggtcggacaggcccgaacctctatggg
gtcttgggtcgtcaggcgggcactaccgactttagatacggtgacgacctcgttgccgcc
ggtgaagccgggcttgtctgggatgccgcaaacttcgcggaatatgttcaggacccacgc
gccttcctgcgcacgtatctggatgattccaaagcgaaatccaaaatggcatataagctg
agaagtggtggcgaagacatcgcagcctatcttgcgtcggtgaccggtagctctagctga

DBGET integrated database retrieval system