KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_0061Help
Entry
Rleg2_0061        CDS       T00779                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rlt01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:rlt00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(61172..62365)
Genome map
AA seq 397 aa AA seqDB search
MTATDPVANLQTLIRCPSVTPAEGGALSALDAMLAPLGFTVDKVKASEAGTADIENLYAR
LGKDGPHLMFAGHTDVVPVGDEADWTHPPFAAEISKGELFGRGAVDMKGGIACFIAAVAR
HIEKNGPPKGSISFLITGDEEGPAINGTIKLLRWAAERGERWDACLVGEPTNPDRLGDMI
KIGRRGSLSGKITVHGVQGHAAYPHLADNPVRGMLQLTQALMDPPFDGGTDDFQPSNLEV
TTVDVGNPATNVIPAKASASFNIRFNDSWTAETLRAEILRRLDAAAGDGRLRPGREPVKY
DIVWADRPSHVFLTRNNALIASLSSAVEGVIGRSPKLSTTGGTSDARFIKDYCPVVEFGL
VGQTMHMVDERVAVSDLETLTAIYETFIAHWFANAGA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctaccgatcccgtcgccaatcttcagacgctgattcgctgcccctcggtgact
ccagccgaaggcggcgcgctgtcggcgctcgacgccatgcttgcgccgctcggcttcacc
gtcgacaaggtgaaagcgagcgaagcgggaaccgccgatattgaaaacctctatgcccgt
ctcggcaaggacggcccgcatctgatgtttgccggccacaccgatgtcgtgccggtcggc
gacgaggccgactggacgcatccgcccttcgccgccgagatatcgaagggcgagctcttc
ggccgcggtgccgtcgacatgaagggcggcatcgcctgcttcatcgccgccgtcgcccgc
catatcgagaaaaacgggccgcccaagggctcgatttccttcctgatcaccggcgatgag
gaaggcccggcgatcaacggcacaatcaagcttctgcggtgggcggccgaacgcggcgag
cgctgggatgcctgcctggtcggcgagcccaccaatccggacaggctgggcgacatgatc
aagatcggccggcgcggctcgctgtcgggcaagatcaccgtgcacggcgtccagggccat
gccgcctatccgcatcttgccgacaatccggtgcgcggcatgctgcagctgacgcaggcg
ctgatggatccgcccttcgacggcggcaccgacgatttccagccctcgaacctcgaggtg
accacggtcgatgtcggcaatccggcgaccaacgtcattccggccaaggcatcggccagc
ttcaacatccgcttcaacgacagctggacggccgagacgctgcgggccgaaatcctgcgg
cgcctcgacgccgccgccggagacggccggctgcggccgggccgcgaaccggtgaaatac
gatatcgtctgggccgaccggccgagccatgtcttcctgacccgcaacaatgccctgatc
gcgtcgctgtcatcagccgtcgaaggcgtgatcggccgctcgcctaagctttccacaacc
ggcggcacctcggatgcgcgtttcatcaaggattattgcccggtcgtcgagttcggcctc
gtcggccagacgatgcacatggtcgacgagcgcgtcgccgtttccgatctggagacgctg
acggcgatctacgagaccttcattgcccactggttcgccaatgccggggcttag

DBGET integrated database retrieval system