KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_0069Help
Entry
Rleg2_0069        CDS       T00779                                 

Definition
(GenBank) fatty acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt01040  Biosynthesis of unsaturated fatty acids
rlt01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Rleg2_0069
Enzymes [BR:rlt01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Rleg2_0069
Lipid biosynthesis proteins [BR:rlt01004]
 Desaturase
  First
   Rleg2_0069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-ProteinID: ACI53372
JGI: Rleg20069
UniProt: B5ZN31
Position
complement(69323..70285)
Genome map
AA seq 320 aa AA seqDB search
MSSISTGRMIDDSSDPVKGRVVWMPAKSVWISAMTMTAIIGGPLTFTWSAFAVFILLTAM
TICLGHSVGMHRLLIHRSFSTPLWIEHFLVYLGTLVGMAGPFGMIYAHDIRDWAQRQRDC
HDLYAHRRSFFTDAFWQMHCAVALNHPPRFVLDERERRDRFYRFLEATWMAQQIPLALAL
LALGGLPWVVWGIAVRVSVSLTGHWLVGHFAHRAGHQGWSVDDVAVQGYNLPHFGLVTFG
ESFHGNHHAFPESARLGIEPGQLDLGWHFIRVLSGLGLASAIKLPHMIVPRQGLKRVNAA
EASGGSHPPYQAAGQAKSRP
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtatttccaccggacgcatgatcgacgatagcagcgatcccgtgaagggcaga
gtggtctggatgccggcaaagtcggtctggatctctgcaatgaccatgaccgccataatc
ggcgggccactaaccttcacctggagcgcctttgccgtcttcatcctcctgaccgccatg
accatctgccttggtcattcggtcggcatgcaccggctgttgatccaccgttccttcagc
acccctctctggatcgagcactttctcgtctatctcggcacgctggtcggcatggccggc
cccttcggcatgatctacgcgcacgatattcgcgactgggcgcaacggcagagagactgc
catgacctctatgcccatcggcggtctttcttcaccgacgccttctggcagatgcattgc
gcagtggcgcttaatcatccgccacgcttcgtcctcgatgagcgcgagcggcgcgaccgc
ttttatcgcttcctggaggcgacatggatggcgcagcagatccccttggcactcgcgctc
ctggcgcttggcggactgccgtgggtggtctggggtattgccgtgcgggtatcggtatcg
ctgaccggacactggctggtcggtcatttcgcgcaccgggccggccatcagggctggagc
gtcgatgatgtcgcggtgcagggttataacctgccgcatttcgggctggtcaccttcggg
gagagcttccacggcaaccatcacgcctttccggaatcggcgcggctcggcatcgagccg
gggcagttggacctcggctggcatttcatccgagtgctgtcggggctcggcctggcttcg
gcgatcaagctcccgcatatgatcgtgccgcggcaagggctgaagcgcgtcaacgccgct
gaagcttctggtggcagtcatccgccatatcaggcggccggccaggcgaaatcgcgcccg
tga

DBGET integrated database retrieval system