KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_0239Help
Entry
Rleg2_0239        CDS       T00779                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rlt01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:rlt00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
244671..245969
Genome map
AA seq 432 aa AA seqDB search
MAIWLDQASEGFEQRFATFLTTKREVSEDVNTVVRAIIDDVRARGDVALAEYSLKFDGID
FATVPMRVTPEEFDAAIEAVPPEVLGALKLAALRIESHHRRQLPKDDIYEDDMGVGLGSR
WTAIEAVGLYVPGGTASYPSSVLMNAVPAKVAGVDRIVIAVPATGGAVNPAVLAAARLVG
VTEVYRVGGAQAIAALAYGTETIAPVAKITGPGNAYVAAAKRHVFGTVGIDMIAGPSEVL
VIADKDNNPDWIAADLLAQAEHDASAQAILITDDAEFGKAVEQAVERQLKTLNRAETAAA
SWRDFGAVILVADLKQAIPLANRIAAEHLELAVADPDRLLDGIRNAGAIFIGAHTPEVIG
DYVGGSNHVLPTARSARFSSGLSVLDFVKRTSILRLGPQQLRTLGPAAIALAVSEGLDAH
ARSVAIRLNLER
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
ttggcaatctggctggatcaggcatcggaaggtttcgagcagcgttttgccacctttctg
acgacgaagcgtgaagtctccgaggatgtgaacaccgtcgttcgcgccatcatcgatgat
gtcagggcccgcggcgatgtggcgcttgccgaatattcgttgaagttcgacggcatcgat
ttcgccaccgtgccgatgcgcgtcacgcctgaggagttcgacgccgcgatcgaggccgtg
cctccggaagtgctgggtgcgctgaagctcgcagcactgcgcattgaatcccatcatcgc
cggcagctgccgaaggacgatatttatgaggacgacatgggcgtcggcctcggctcgcgc
tggacggcgatcgaggcggtcgggctctatgttccgggcggcaccgcgagttatccgagc
tcggtgctgatgaatgccgtgccggccaaggttgcaggcgtcgatcgcatcgtcatcgcc
gttcccgccaccggcggtgccgtcaatccggcggtgcttgccgccgccaggcttgtcggt
gtgaccgaggtttatcgtgtcggcggcgcccaggcgatcgcggctcttgcctatggcacc
gagacgatcgccccggttgccaagatcaccggtcccggcaatgcctatgtcgcagccgcc
aagcgccatgtcttcggcactgtcggcatcgatatgatcgccggcccttccgaagtgctc
gtcatcgccgacaaggacaacaatcccgattggatcgccgccgacctgctggcgcaggcc
gagcacgatgccagcgcccaggcgatcctgatcaccgacgatgccgaattcggcaaggcg
gtggagcaggcggtcgagcgccagctgaagacgctgaaccgtgccgagaccgccgcggca
agctggcgcgatttcggcgcggtcattctcgttgccgatctgaagcaggccattccgctt
gccaaccgcatcgccgccgagcatctggagcttgccgtcgccgatccggatcggctgctc
gacggcatccgcaatgccggcgcgatcttcatcggcgctcatacgcccgaggtgatcggc
gattatgtcggcgggtccaaccacgtgctgccgacggcgcgctcggcgcgtttctcctcc
ggcctttcggtgctcgatttcgtcaagcgcacctcgatcctgcggctcggcccgcagcaa
ttgcgcaccctcggcccggcggcgattgctctagccgtctccgaaggcctcgatgctcat
gcgcgatcggttgcgatccgcctcaacctcgaaaggtga

DBGET integrated database retrieval system