KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_0301Help
Entry
Rleg2_0301        CDS       T00779                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rleg2_0301
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Rleg2_0301
Enzymes [BR:rlt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Rleg2_0301
Two-component system [BR:rlt02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Rleg2_0301
Bacterial motility proteins [BR:rlt02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Rleg2_0301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
308074..309117
Genome map
AA seq 347 aa AA seqDB search
MSAPARVLVVDDSPTMRGLITAVLSSDPEVNVIGQAGDALEAREAIKRLNPDVVTLDIEM
PNMNGLDFLEKIMTLRPMPVIMVSTMTHRGAEASLAALEIGAFDCVGKPAPGELRPFGDL
AEKVKAAARTQRQFSQPVAAPAPPPSVADFRVGRKIVAIGSSTGGVEALIAVLQKFPANC
PPTVITQHMPPTFTKSFAERLNRLCAPVVQEATDGARLEIGKIYLAPGGERHLQVSNASA
PCCRLVDRAPVNGHRPSVDVLFDSVAELAGRNAVGVILTGMGRDGAAGLLKMRHAGARTL
GQNEKTCVVYGMPRVAHELGAVEQQLPLSAIGEEILKMTAARKEGTE
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctccggcaagggttctcgtcgttgacgactccccgacgatgcgggggctgatc
accgccgtcctcagttccgaccccgaggtcaacgtcatcggccaggccggcgatgcgctg
gaagcgcgcgaggccatcaagcggctgaaccccgacgtcgtgacgctcgacatcgagatg
ccgaacatgaacggtctcgatttcctcgaaaagatcatgacgctgcgtccgatgccggtc
atcatggtatcgacaatgacccatcgcggcgccgaggcgtcgcttgcagcgctcgagatc
ggcgcgttcgactgcgtcggcaagccggcgccgggcgaactcaggcccttcggcgacctc
gccgagaaggtcaaggccgccgcgcgcacacagcgccagttctcccagccggttgccgcc
ccggcacctccgccctccgtcgctgatttccgcgtcggccgcaagatcgtcgcgatcggc
tcgtccacaggtggcgtcgaggcgctgatcgccgtgctgcagaagtttccggccaattgc
ccgccgaccgtcatcacccagcatatgccgccgaccttcaccaagagcttcgccgaacgc
ctgaaccgcctctgtgcgccggtggtgcaggaagcgaccgacggtgcccgcctcgaaatc
ggcaagatctatctggcgccgggcggcgagcgtcatctccaggtcagcaacgcctcggcg
ccgtgctgccgtctcgtcgaccgggcgccggtcaacggtcaccgcccatcggtggacgtc
ctcttcgattcggtcgccgaactggctggccgcaacgccgtcggcgtgatcttgaccgga
atgggccgcgatggcgccgccggattgttgaaaatgcgccacgccggcgccagaacactc
ggccagaacgaaaaaacctgtgtcgtttacggaatgccaagggttgctcatgaacttggc
gccgtggagcagcagttgcccctgtctgccatcggtgaagaaatattgaaaatgacagcc
gcccgaaaggaagggaccgaataa

DBGET integrated database retrieval system