KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_0373Help
Entry
Rleg2_0373        CDS       T00779                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rleg2_0373
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rleg2_0373
Enzymes [BR:rlt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Rleg2_0373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(380300..381589)
Genome map
AA seq 429 aa AA seqDB search
MTDFYKLVPNAPTGRFDGIDRPYSADDVRRLRGSVALTHTLAEMGADRLWRLLRQEDFVN
ALGALSGNQAMQMVRAGLKAIYLSGWQVAADANTASAMYPDQSLYPANAGPELAKRINRT
LQRADQIETSEGQGLSVDSWFAPIVADAEAGFGGPLNAFEIMKAYIEAGAAGVHFEDQLA
SEKKCGHLGGKVLIPTAAHIRNLNAARLAADVMGVATLVIARTDAEAAKLLTSDIDERDQ
PFVDYDAGRTVEGFYQVRNGIEPCIARAVAYAPYCDLIWCETSKPDLDQARRFAEGVHRV
HPGKLLAYNCSPSFNWKKNLDEATIAKFQRELGAMGYKFQFITLAGFHQLNYGMYELARG
YRQRQMSAYSELQQAEFDAEVNGYTATKHQREVGTGYFDAVSLAITGGRSSTTAMHDSTE
HAQFKPAAE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttttacaaacttgttcccaatgcaccgacaggccgcttcgacggcatcgac
aggccctattcggccgatgacgtgcggcggctgaggggctcggtggcgctgacccatacg
ctcgccgaaatgggggcggaccggttgtggcggctgctgcgccaggaggatttcgtcaat
gcgctcggcgcgctttccggcaaccaggcgatgcagatggtgcgcgccggactgaaggcg
atctatctctccggctggcaggtggcggccgacgccaatacggcatcggcgatgtatccc
gatcagtcgctctaccccgccaatgccgggccggagcttgccaagcgcatcaatcgcacg
ctgcagcgcgccgatcagatcgagacctcggagggtcaggggctttccgtcgacagctgg
ttcgcgccaatcgtcgccgatgcggaagccggcttcggcgggccgctcaacgccttcgag
atcatgaaggcctatatcgaggcgggtgcggccggcgtccacttcgaggatcagcttgcc
tcggaaaagaaatgcggccatctcggcggcaaggtattgatcccgacggccgcccatatc
cgcaatctcaacgccgcccggcttgccgccgacgtcatgggcgttgcgacgctggtgatt
gcccgcaccgacgcggaagcggcaaagctgctgacatccgatatcgacgaacgcgaccag
cccttcgttgattatgatgccgggcgcaccgtcgaaggcttctatcaggtcaggaacggc
atcgaaccctgcatcgcccgggccgttgcctatgcaccctattgcgatctgatctggtgc
gagacctcgaagcccgacctcgatcaggcgcggcggtttgccgaaggcgtgcacagggtc
catcccggcaagctgctcgcctataattgctcgccgtccttcaactggaagaaaaacctc
gacgaggcgacgatcgcaaagttccagcgcgaactcggcgcgatgggctacaagttccag
ttcatcacgctcgccggcttccaccagctgaattacggcatgtacgagctggcgcgcggc
taccggcagcggcagatgtcggcctattcggagctgcagcaggcggaattcgacgccgag
gtcaacggctataccgccaccaaacatcagcgcgaggtcggcaccggctatttcgacgcg
gtgtcgcttgccatcaccggcggccggtcgtcgaccacggcaatgcacgattcaaccgaa
catgcgcagttcaaaccggctgcggaatag

DBGET integrated database retrieval system