KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_0573Help
Entry
Rleg2_0573        CDS       T00779                                 

Definition
malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rleg2_0573
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rleg2_0573
Enzymes [BR:rlt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     Rleg2_0573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
596546..597970
Genome map
AA seq 474 aa AA seqDB search
MPEASFFTDMLQSITDHGRQLLFSGSRNTQAAAKADLQTLCEMLLSSRGEASGMALAAEI
LDRWGGLESAGAQQFFHMLHETFGPDTVRLDQAMENYRTDKSSAAVIALHQAAEPRRQEL
LRRLNHAPNGTARLVRMRQQLLASKDRSEAYHALDADFTHLFGSWFNRGFLTLRPIDWST
PANILEKIIKYEAVHEIASWEELRRRLAPADRRCFAFFHPRLAEEPLVFVEVALTRSVPN
AIADVLDEGREQINADEATTAVFYSISNCQDGLRGISFGNFLIKQVVEDLRRDLPGLKNF
VTLSPVPGFARWLAKARDPAGARSLSKAALETLNLLDDPNWPDEEKSRTELERVLLPLAA
RYFLTERTPEGRPVDPVARFHLGNGARLERVNFLGDRSQKAVQQAHGLMVNYLYKLDDIV
ANHEALAQRGEVIASPAVKSLLNQNDEGRRGGNGQQGSRAFAQIMNSTLGGGRK
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaagcttctttcttcaccgacatgttgcaaagcattaccgatcacggacgccag
cttctgttttccggctcgcgcaacacccaggccgcagccaaagccgatctgcagactctc
tgcgagatgctgttgtcgagccggggtgaagcatccggcatggcccttgcggccgagata
ctcgatcgctggggcgggctcgaaagcgcgggcgcgcagcaattcttccatatgcttcac
gaaacgttcgggcccgacacggtgcggctcgaccaggcgatggaaaattaccgcactgac
aaaagctctgccgccgtcatcgcgctccatcaggccgccgagccgcggcggcaggagctc
ctgcgccgcttgaatcacgcgccgaacggcaccgccaggctggtccgtatgcgtcagcag
ctgcttgcttccaaggaccggtccgaagcctatcacgcgctcgatgccgatttcacgcat
ctgttcggctcctggttcaatcgtggctttctgacgctgcggccgatcgactggtcgacg
ccggcaaacatcctcgaaaagatcatcaaatacgaggccgtgcatgagatcgccagctgg
gaggagttgcgccgccggctggcgccggccgaccgtcgatgctttgcctttttccatccc
cgattggccgaagaaccgctggtgttcgtcgaggtggcgctcacccgatccgtgcccaat
gcgatcgcagatgtcctcgacgaggggagggagcagatcaatgccgatgaggcgacgacg
gctgtcttctactcgatctccaactgccaggatggcctgcgcggaatctcgttcggcaat
ttcttgatcaagcaggtcgtggaagacctgcgccgggacctaccgggcctgaagaatttc
gtcacgctgtcgcctgtcccgggctttgcccgctggcttgccaaggcgcgcgatccggcc
ggcgcccggtccttgtccaaagcggccctggaaacgctgaacctgctggacgacccgaac
tggcccgacgaggagaagagcaggaccgaattggagcgcgtgttgctgccgcttgcggcg
cgctacttcctgaccgaacgaacgcctgagggccgcccggtcgatcccgtcgcccgcttc
catctcggcaacggcgctcggctcgaaagagtgaattttctcggcgaccgatcgcagaag
gcagtccagcaggcccacggcctgatggtcaactacctctataagctcgacgacatcgtg
gccaatcacgaggccttagcgcagcgcggcgaagtgatcgcctcgccagccgtcaaaagc
ctgctcaaccagaacgacgaaggccgtcgcggcggcaacggccagcaaggctctcgggcc
ttcgcgcagatcatgaactcaacgcttggaggagggcgaaagtga

DBGET integrated database retrieval system