KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_0635Help
Entry
Rleg2_0635        CDS       T00779                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rlt01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:rlt00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:rlt00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(660113..661528)
Genome map
AA seq 471 aa AA seqDB search
MDYISTRGEAPALGFCDALLTGLARDGGLYVPREWPQFSKKEIRALRGKTYQEIAFTILS
PFTNGEIPEATFRAMIDEAYGTFRHPAIAPLVQTGPNSFVMELFHGTTLAFKDVAMQLLA
RLMDYALEKRGERATIVGATSGDTGGAAIDAFAGRERTDIFILFPHGKVSPVQQRQMTTS
TAANVHALAVEGNFDDCQNLVKAMFNDAAFRDKVNLSGVNSINWARIMAQIVYYFTTAVA
LGGPDRKISFTVPTGNFGDIFAGYCAKRMGLPIDRLVIATNENDILARTLKTGRYDMKAV
KATSSPSMDIQISSNFERLLFEAYGRDASKVRAAMESLKQSNGFEIGPQALKAIRRDFRA
GRASEKQVAETIRKTHAETGYLLDPHSAIGVFVASKKEKPNTPMVTLSTAHPAKFPAAVK
SACGIDPALPTWLADLMHREERFQIIEPELKAVETFIGKHARGKTTAGAER
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtggactatatctcgacccgcggcgaggcccctgccctcggcttttgcgacgccctgctg
acgggcctggcgcgcgatggcgggctctatgttccccgtgaatggccgcagttttcgaag
aaagaaatccgcgcgctgaggggcaagacctatcaggaaatcgccttcaccatcctttcg
cccttcaccaatggcgagatccccgaggcgaccttccgggcgatgatcgacgaggcctac
ggcaccttccgccatccggcgatcgcgccgctcgtccagaccgggccgaacagttttgtc
atggagctgttccacggcacgacgctcgccttcaaggatgtggcgatgcagctgctcgca
cggctgatggattatgcacttgagaagcgcggcgagcgggcgacgattgtcggcgccacg
tcgggtgataccggcggggcggcgatcgacgcctttgccgggcgcgagcgcaccgacatc
ttcattctcttcccgcatggcaaggtctcgccggtgcagcagcggcagatgacgacgtca
acggccgccaatgtgcatgcgcttgccgtcgaaggcaatttcgacgattgccagaacctg
gtgaaggcgatgttcaacgacgcggcgttccgcgacaaggtcaatctctccggcgtcaac
tcgatcaactgggcgcgcatcatggcccagatcgtctattatttcacgaccgcggtggcc
ttgggcgggccggaccggaagatctcgttcacggtgccgacaggcaatttcggcgatatc
ttcgccggctactgcgccaagcgcatgggtctgccgatcgaccggctggtcatcgccacc
aacgaaaacgacattctggcgcggacactgaagaccggccgctacgacatgaaggctgtg
aaggcaacgagctcgccgtcgatggatatccagatctcgtcgaatttcgaacggctgctt
ttcgaagcctatggacgcgacgcctcgaaggtgcgcgcggccatggaaagcctcaagcaa
tccaacggcttcgagatcggcccgcaggcattgaaggcgatccgccgcgacttccgggcc
ggccgcgccagcgagaaacaagtggccgagacgatccgcaagacccatgccgagaccggc
tatctccttgatccgcattcggcgatcggcgtcttcgtcgccagcaagaaggaaaagccg
aatacgccgatggtgacgctttcgaccgcgcatccggcgaaattccccgccgccgtaaaa
tcggcctgcggtattgacccggcgcttccgacgtggcttgctgatctgatgcacagggag
gagcgcttccagatcatcgaaccggagctgaaagccgtagagacctttatcggcaaacac
gcccgcggcaagacgacggcaggcgcagaaagatag

DBGET integrated database retrieval system