KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_0831Help
Entry
Rleg2_0831        CDS       T00779                                 

Definition
alcohol dehydrogenase zinc-binding domain-containing protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Rleg2_0831
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rleg2_0831
  Lipid metabolism
   00071 Fatty acid degradation
    Rleg2_0831
  Amino acid metabolism
   00350 Tyrosine metabolism
    Rleg2_0831
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rleg2_0831
   00626 Naphthalene degradation
    Rleg2_0831
Enzymes [BR:rlt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Rleg2_0831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(849340..850383)
Genome map
AA seq 347 aa AA seqDB search
MKAMYYEAFEQAPEIRTLPDPTPSEDGVVISVGASGLCRSDWHGWMGHDPDIRLPHVPGH
ELAGKIVATGRGVMRFKVGDRVTVPFVSGCGHCGECHSGNQQVCPNQFQPGFTHWGSFAE
YVAIDYADTNLVHLPETIDDATAASLGCRFATSFRAVADQARTGPGEWIAVHGCGGVGLS
AIMIATALGANAIGIDISEEKLAFARECGAVATVNASGVADVAEAVREITKGGAHVSIDA
LGHPATCFNSIKNLRRRGRHVQVGLMLGEHATPQIPMAQVIGHELEIYGSHGMQAWRYDA
MLSMLAAGKIAPQKLIGRRVTLEEAVPTLMALDKAEATGISVITRFS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccatgtattacgaagccttcgagcaggcgcccgagatccgcaccctgcccgat
ccgacgccttccgaggacggcgtcgtcatatcggtcggcgccagcgggctctgccgcagc
gactggcacggctggatggggcatgaccccgatatccgcctgccgcatgtgccggggcac
gagcttgccggaaagatcgtcgccaccggccgcggtgtgatgcgtttcaaggtgggcgac
cgggtgactgtgccgttcgtttccggctgtggccattgcggagagtgccattccggcaac
cagcaggtctgcccgaaccagttccagccgggcttcacccattggggatccttcgccgaa
tatgtggcgatcgattatgccgacaccaatctggtgcatctgcccgagacgatcgacgat
gcgacggcggcaagcctcggctgccgcttcgccacctcgttccgcgccgtcgccgaccag
gcacgcaccgggcccggcgaatggatcgccgtgcatggctgcggcggcgtcggcctgtcg
gcgatcatgatcgccacggcactcggcgccaatgcgatcggcatcgacatatccgaggag
aagctcgccttcgccagagagtgcggggcagtggcaacggtcaatgcctccggcgtcgcg
gatgtggcggaggcggtgcgcgagatcactaaaggcggcgcgcatgtctcgatcgacgcg
ctcggccatcccgccacctgcttcaactcgatcaagaatctgcgccggcgcggccggcat
gtgcaggtggggctgatgctcggcgaacatgccacgccgcaaatcccgatggcgcaggtg
atcggccacgaattggagatctacggcagccacggcatgcaggcctggcgctatgacgcc
atgctgtcgatgctggcggccggcaagatcgccccgcagaagctgatcggacgtcgagtc
accttggaggaggccgtgccgacgctgatggcgctcgacaaggcggaggccacggggatc
agcgtgattacgcggttttcgtga

DBGET integrated database retrieval system