KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_1062Help
Entry
Rleg2_1062        CDS       T00779                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt00230  Purine metabolism
rlt01100  Metabolic pathways
Module
rlt_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Rleg2_1062
Enzymes [BR:rlt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Rleg2_1062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 AAA_18 AAA_22 ABC_tran AAA_29 Cytidylate_kin MMR_HSR1 RsgA_GTPase AAA_30 cobW AAA_24
Motif
Other DBs
NCBI-ProteinID: ACI54356
JGI: Rleg21062
UniProt: B5ZWD7
Position
1080065..1080727
Genome map
AA seq 220 aa AA seqDB search
MNPAKSSPVQIARRGLMLVISSPSGAGKSTIARTLLEKDRQIGLSVSVTTRQRRPSEIED
VHYHFKSVREFERMRDSDALLEWAEVHGNFYGTPREPVEQAMAEGRDMLFDIDWQGAQQL
QEKMSADVVSIFVLPPTMTELQSRLHRRAEDSEDVIQTRLANSRAEIAHWREYDYVIVND
DLNAAFDAVQSIVKAERLRRDRRHGMFDFVRELLEETPSL
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaatccggcgaaatcctcgcccgtccagatcgcccgccgcggtctgatgcttgtcatt
tcgtcgccgtcgggcgccggcaagtccaccatcgcgcgcacgctgctggagaaggacagg
caaatcggcctctccgtcagcgtcaccacgcgccagcgccgcccgagcgaaatcgaggat
gtgcattaccacttcaagagcgtgcgcgagttcgagcggatgcgcgacagcgacgcgctg
ctcgaatgggccgaagtgcatggcaatttctacggcacgccgcgcgagcctgtggagcag
gccatggccgagggccgcgacatgctcttcgatatcgactggcagggcgcccagcaattg
caggaaaagatgtcggccgacgtcgtttcgatcttcgtgctgccgccgaccatgaccgag
ctgcagtcgcggctgcaccgccgcgccgaggattccgaggatgtcatccagacgcgcctg
gccaacagccgcgccgagatcgcccactggcgcgaatatgactatgtcatcgtcaacgac
gacctcaacgccgccttcgacgccgtccagtcgatcgtcaaggccgaacgcttgcgccgc
gaccgccgccacggcatgttcgatttcgtccgcgagctgctggaagagacgccgtcgctt
tag

DBGET integrated database retrieval system