KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_1062Help
Entry
Rleg2_1062        CDS       T00779                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:rlt00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1080065..1080727
Genome map
AA seq 220 aa AA seqDB search
MNPAKSSPVQIARRGLMLVISSPSGAGKSTIARTLLEKDRQIGLSVSVTTRQRRPSEIED
VHYHFKSVREFERMRDSDALLEWAEVHGNFYGTPREPVEQAMAEGRDMLFDIDWQGAQQL
QEKMSADVVSIFVLPPTMTELQSRLHRRAEDSEDVIQTRLANSRAEIAHWREYDYVIVND
DLNAAFDAVQSIVKAERLRRDRRHGMFDFVRELLEETPSL
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaatccggcgaaatcctcgcccgtccagatcgcccgccgcggtctgatgcttgtcatt
tcgtcgccgtcgggcgccggcaagtccaccatcgcgcgcacgctgctggagaaggacagg
caaatcggcctctccgtcagcgtcaccacgcgccagcgccgcccgagcgaaatcgaggat
gtgcattaccacttcaagagcgtgcgcgagttcgagcggatgcgcgacagcgacgcgctg
ctcgaatgggccgaagtgcatggcaatttctacggcacgccgcgcgagcctgtggagcag
gccatggccgagggccgcgacatgctcttcgatatcgactggcagggcgcccagcaattg
caggaaaagatgtcggccgacgtcgtttcgatcttcgtgctgccgccgaccatgaccgag
ctgcagtcgcggctgcaccgccgcgccgaggattccgaggatgtcatccagacgcgcctg
gccaacagccgcgccgagatcgcccactggcgcgaatatgactatgtcatcgtcaacgac
gacctcaacgccgccttcgacgccgtccagtcgatcgtcaaggccgaacgcttgcgccgc
gaccgccgccacggcatgttcgatttcgtccgcgagctgctggaagagacgccgtcgctt
tag

DBGET integrated database retrieval system