KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_1071Help
Entry
Rleg2_1071        CDS       T00779                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Rleg2_1071
   00240 Pyrimidine metabolism
    Rleg2_1071
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Rleg2_1071
   03430 Mismatch repair
    Rleg2_1071
   03440 Homologous recombination
    Rleg2_1071
Enzymes [BR:rlt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Rleg2_1071
DNA replication proteins [BR:rlt03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Rleg2_1071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1090813..1091262
Genome map
AA seq 149 aa AA seqDB search
MTDVLFYHLTETKLEDALPPLIDKSVERGWRVAVQTREAARRDALDAHLWTFREESFLPH
GTDEGDFAENQPVLLTVTSGNANAATVRFIIDGAEPPPLDAYERVVFMFDGHDQAQLEAA
RAQWKKLKGEGHNLTYWQQTPEGRWEKKA
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgttctcttttatcatctgaccgaaaccaagctggaagacgcgcttccgccg
ctgatcgacaaaagcgtcgagcgcggctggcgcgtcgccgtccagacgcgcgaggcggcg
cggcgcgatgctctcgacgcgcatctctggacgttccgcgaggagagttttctgccgcac
ggcaccgacgagggcgatttcgccgaaaaccagccggtgcttttgaccgtgacatcaggc
aatgccaatgcggcgaccgtgcgtttcatcatcgacggcgccgagccgccgccgctcgat
gcctatgaacgcgtcgtcttcatgttcgacggccacgaccaggcgcaactggaggccgcc
cgggcgcaatggaagaagctgaaaggcgaggggcataacctcacctattggcagcagacg
ccggaagggcggtgggagaagaaggcttga

DBGET integrated database retrieval system