KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_1113Help
Entry
Rleg2_1113        CDS       T00779                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt00860  Porphyrin and chlorophyll metabolism
rlt01100  Metabolic pathways
rlt01110  Biosynthesis of secondary metabolites
rlt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rleg2_1113
Enzymes [BR:rlt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Rleg2_1113
Exosome [BR:rlt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rleg2_1113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ACI54407
JGI: Rleg21113
UniProt: B5ZX30
Position
complement(1138094..1139107)
Genome map
AA seq 337 aa AA seqDB search
MQDRTHLVDDITGHRRMRRNRKAEWTRRLVQENRLTVDDLIWPIFIVPGSGIVDPIPAMP
GVNRMSIDKAVEAAREAAGLGIPALATFPNIEMELRDETGSNSLEANNLINKATSAIKKA
VPNIGVITDVALDPFTSHGHDGILRGSEIVNDETVDQVARAAVMQADAGADIIAPSEMMD
GRIGAIRMALDAAGHQSVGIMSYATKFASAFYGPYREAISTGGLLKGDKKTYYIDPANGT
EAIRDAALDVEEGADMLMVKPGLPYLDICWRMKEAFGLPTFAYQVSGEYSQIKAAAMNGW
IDGERAMLETLLSFKRAGCDGILTYFAVEVAKVLAKR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcaggataggacgcatctcgtcgacgacatcaccggccatcgccgcatgcggcgcaac
cgcaaggcggaatggacacgccggttggtgcaggagaaccggctgacggtcgacgacctg
atctggccgatcttcatcgtgcccggctccggcatcgtcgatccgatcccggccatgccg
ggcgtcaaccgcatgagcatcgacaaggccgtcgaggcagcacgcgaagcggccggcctc
ggcattccagcgctcgcgacctttccgaatatcgagatggaactacgcgacgaaacgggc
tcgaacagcctcgaagccaataatctgatcaataaggcgacgtcggcgatcaagaaggcg
gtgcccaatatcggcgtcatcaccgacgtcgcgctcgatcccttcaccagccatggccat
gacggcattttgagaggcagcgagatcgtcaacgacgagacggtcgatcaggtggcgcgt
gccgccgtgatgcaggcggatgccggcgccgacatcattgcgccgtccgagatgatggac
gggcgcatcggcgcaatccgcatggcgcttgatgcagccggccaccagagcgtcggcatc
atgagctatgcgacgaaattcgcttccgccttctatggcccctatcgcgaggcgatctcg
acgggcgggctgctgaagggtgacaagaagacctattatatcgacccggccaacggcacc
gaggcgatccgcgatgcggccctcgacgtcgaggaaggtgctgatatgctgatggttaag
cccggcctgccctatctcgacatctgctggcggatgaaggaggccttcggcctgccgacc
ttcgcctaccaggtttccggcgaatattcgcagatcaaggcagcggcgatgaatggctgg
atcgacggcgagcgggcgatgctcgaaacgctgctgtcgttcaagcgggcgggatgcgac
ggcatcctcacctatttcgcggtcgaggtggcgaaagtcctcgcgaagcggtga

DBGET integrated database retrieval system