KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_1113Help
Entry
Rleg2_1113        CDS       T00779                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rlt00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1138094..1139107)
Genome map
AA seq 337 aa AA seqDB search
MQDRTHLVDDITGHRRMRRNRKAEWTRRLVQENRLTVDDLIWPIFIVPGSGIVDPIPAMP
GVNRMSIDKAVEAAREAAGLGIPALATFPNIEMELRDETGSNSLEANNLINKATSAIKKA
VPNIGVITDVALDPFTSHGHDGILRGSEIVNDETVDQVARAAVMQADAGADIIAPSEMMD
GRIGAIRMALDAAGHQSVGIMSYATKFASAFYGPYREAISTGGLLKGDKKTYYIDPANGT
EAIRDAALDVEEGADMLMVKPGLPYLDICWRMKEAFGLPTFAYQVSGEYSQIKAAAMNGW
IDGERAMLETLLSFKRAGCDGILTYFAVEVAKVLAKR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcaggataggacgcatctcgtcgacgacatcaccggccatcgccgcatgcggcgcaac
cgcaaggcggaatggacacgccggttggtgcaggagaaccggctgacggtcgacgacctg
atctggccgatcttcatcgtgcccggctccggcatcgtcgatccgatcccggccatgccg
ggcgtcaaccgcatgagcatcgacaaggccgtcgaggcagcacgcgaagcggccggcctc
ggcattccagcgctcgcgacctttccgaatatcgagatggaactacgcgacgaaacgggc
tcgaacagcctcgaagccaataatctgatcaataaggcgacgtcggcgatcaagaaggcg
gtgcccaatatcggcgtcatcaccgacgtcgcgctcgatcccttcaccagccatggccat
gacggcattttgagaggcagcgagatcgtcaacgacgagacggtcgatcaggtggcgcgt
gccgccgtgatgcaggcggatgccggcgccgacatcattgcgccgtccgagatgatggac
gggcgcatcggcgcaatccgcatggcgcttgatgcagccggccaccagagcgtcggcatc
atgagctatgcgacgaaattcgcttccgccttctatggcccctatcgcgaggcgatctcg
acgggcgggctgctgaagggtgacaagaagacctattatatcgacccggccaacggcacc
gaggcgatccgcgatgcggccctcgacgtcgaggaaggtgctgatatgctgatggttaag
cccggcctgccctatctcgacatctgctggcggatgaaggaggccttcggcctgccgacc
ttcgcctaccaggtttccggcgaatattcgcagatcaaggcagcggcgatgaatggctgg
atcgacggcgagcgggcgatgctcgaaacgctgctgtcgttcaagcgggcgggatgcgac
ggcatcctcacctatttcgcggtcgaggtggcgaaagtcctcgcgaagcggtga

DBGET integrated database retrieval system