KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_1231Help
Entry
Rleg2_1231        CDS       T00779                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Rleg2_1231
Enzymes [BR:rlt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Rleg2_1231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1244172..1245134)
Genome map
AA seq 320 aa AA seqDB search
MANKSIDHAFTATSLTSAASDPTFAGALSFMRRRFTKELAGVDVAVWGIPFDAATSNRPG
TRFGPQAIRRASAIFDNDAQYPFNRDLFAEMAVIDYGDCLLDYGNHQDTPAAIERQANVI
LDSGAFLLTLGGDHYVTWPLLKAHAAKHGPLALVQFDAHQDTWFDEDRRIDHGSFVARAA
REGIIDPDRSIQIGIRTHAPEDFGVNILYGHQVEEMSAGDIASAIISHTRGAPAYLTFDI
DCLDPAFAPGTGTPVAGGPSSAKILSVLQRLHQLDIRGADIVEVSPPYDHADITAIAGAT
VAMYMLGLHAERRAIAVSQG
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
ttggcgaacaagtccattgatcatgccttcacggcgaccagcctcacttccgccgccagc
gacccgacctttgccggcgcgctgtcgttcatgcgccgccgcttcaccaaggagctcgcc
ggcgtcgacgtggccgtctggggcattcccttcgatgcggcaacctcgaacaggccaggt
acgcgcttcgggccgcaggcgatccgccgcgcctcggcgatcttcgacaatgatgcgcaa
tatcccttcaaccgcgatctgttcgccgagatggccgtgatcgactacggcgactgcctg
ctcgattacggcaatcatcaggatacgcctgccgccatcgaacgtcaggcgaatgtcatt
ctcgacagcggcgccttcctgctgacgctcggcggcgatcactatgtcacctggccgctg
ctgaaagcgcatgcggcaaaacatgggccgctcgcccttgtgcagttcgacgcgcaccag
gacacctggttcgacgaagaccggcgcatcgaccacggttccttcgtggcacgcgccgcc
cgcgagggcatcatcgatcccgaccgctcgatccagatcggcatccgcacccatgcgccg
gaggatttcggcgtcaatattctctacggccatcaggtcgaggaaatgagcgccggcgat
atcgcctcggcgatcatctcgcatacgcgcggcgcgcctgcctatctcaccttcgatatc
gattgcctcgacccggcctttgcgccgggcaccggcacaccggtcgccggcggaccatcg
agcgccaagatcctctcggtgctgcagcgcctgcaccagctcgatatccgcggcgccgat
atcgtcgaggtatcgccgccctacgaccatgccgatatcaccgccattgcgggggcaacg
gtggcgatgtatatgctggggcttcatgccgagcgacgcgccatcgccgtgtcacaaggc
tga

DBGET integrated database retrieval system