KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_1257Help
Entry
Rleg2_1257        CDS       T00779                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:rlt00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:rlt00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1274600..1275148
Genome map
AA seq 182 aa AA seqDB search
MAGNVLDIPVKSVDGRETTLSEYKGRVLLVVNVASKCGLTVQYEGLEKLYGEKRERGFVI
AAFPANDFKGQEPGTDAEILDFCTSTYDVTFPIFSKISVKGETQHPLYRQLTKSGVKTTG
DGPMRERLKSHGISGGDEDDILWNFEKFLIGRDGKVAARFAPDVTADDSRLVSAVDKELA
KG
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcaatgtgctggatatccctgtcaaatcagtggatggtcgtgaaacgacactc
agcgaatacaagggcagggtgctcttggtcgtcaacgttgcctcgaaatgcgggctgacc
gttcaatatgagggcctcgaaaagctctacggcgaaaagcgcgagcgcggcttcgtcatc
gccgctttccccgccaacgacttcaagggccaggagcccggcaccgacgccgagatcctc
gacttctgcaccagcacctacgacgtcaccttcccgatcttctcgaagatttcggtcaag
ggcgagacccagcaccccctctaccggcaactgaccaaatcgggcgtgaagaccacaggt
gacggcccgatgcgcgaacgcctgaaatcccacggcatatcgggcggcgacgaggacgat
atcctctggaacttcgaaaaattcctgatcggccgcgacggtaaagtcgctgcccgattc
gcccccgatgtgacggccgatgattcgcggctggtttcggcggtggataaggaactggcg
aaggggtga

DBGET integrated database retrieval system