KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_1473Help
Entry
Rleg2_1473        CDS       T00779                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Brite
Enzymes [BR:rlt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Rleg2_1473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1500709..1501371
Genome map
AA seq 220 aa AA seqDB search
MDFEAARVKMVDTQVRTTDVTSHSVLTAFLTVPREAFVPEKAKLLAYIDNDVEISAAAPG
KPARFLMEASPLAKLLQLAAITKDDFVLEVGCGTGYTSALLSIIAGSVIALECDEALAAE
AKTQLAGYAKVEVVSGSLEKGYAAGAPYDLIFINGSVEEVPAALLDQLRDGGRLITVEGH
GNAARAKVFVAERGAVSENVFFNASVKPLPGFAKAREFVF
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggatttcgaagcagcgcgcgtaaagatggtcgacacccaggttcgcacgacggacgtt
acctcgcattccgtgctgacagcgtttctcacggtcccgcgtgaggcattcgtgccggag
aaggcgaagcttctggcttacatcgacaacgatgtcgagatatcggccgccgcgcccgga
aagccggcgcgcttcctgatggaggcatcgccactcgccaagctgctgcagctcgccgca
atcaccaaggatgatttcgtcctcgaagtcggttgcggcaccggttacacatcggcgctg
ctgtcgatcattgccggctccgtcatcgcgctcgaatgcgacgaggcgctggccgccgag
gcgaagacccagctcgccggctacgccaaggtcgaggtggtctccggatcgctcgaaaag
ggctacgctgccggcgctccctatgatctgatttttatcaacggttctgttgaggaggtg
cccgcagcccttctcgatcaattgcgcgatggcggccgtctgatcacggtcgaaggtcac
ggcaatgccgcccgcgccaaggtgttcgtcgccgagcgcggcgccgtttcggaaaacgtc
ttcttcaatgcctccgtcaagccgctgccgggcttcgccaaggcgcgcgaattcgtcttc
tga

DBGET integrated database retrieval system