KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_1946Help
Entry
Rleg2_1946        CDS       T00779                                 

Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt00220  Arginine biosynthesis
rlt00250  Alanine, aspartate and glutamate metabolism
rlt00471  D-Glutamine and D-glutamate metabolism
rlt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rleg2_1946
   00220 Arginine biosynthesis
    Rleg2_1946
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Rleg2_1946
Enzymes [BR:rlt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Rleg2_1946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: ACI55231
JGI: Rleg21946
UniProt: B5ZRF0
Position
complement(1989599..1990528)
Genome map
AA seq 309 aa AA seqDB search
MADLQAILDSIHTDILPRIGEGKVADYIPELAKVDPRQFGMAIVTVDGKVYRVGDADIAF
SIQSISKVFMLTLALGKVGESLWKRVGREPSGSAFNSIVQLEHEGGIPRNPFINAGAIAV
SDVVMAGHAPREAIGELLRFVRYLADDESITIDDKVARSETQTGYRNVALANFMRAYRNL
DHPVDHVLGVYFHQCALSMSCEQLARAGLFLAARGSNPMTGHSVVSPKRARRINALMLTC
GHYDGSGDFAYHVGLPGKSGVGGGIFAVAPGIASIAVWSPGLNKVGNSQLGAVALEMLAA
RTGWSVFGD
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggcggatctgcaggcaatcctcgatagtatccataccgatatcctcccgcgcatcggc
gagggcaaggtcgccgactatattcccgagcttgccaaggtcgatccacggcagttcggc
atggcgatcgtcaccgtcgacggcaaggtctatcgtgtcggcgatgccgacattgccttc
tcgatccagagcatctccaaggtctttatgctgaccttggcgctcggcaaggtcggcgag
agcctctggaagcgcgtcgggcgagaaccatccggatcggccttcaattccatcgtccag
ctcgagcacgagggcggcatcccgcgcaatcccttcatcaatgccggcgcgatcgccgtt
tccgacgtcgtcatggccggccatgcgccgcgtgaggcgatcggcgaattgctgcgcttc
gtgcgttatctcgccgatgacgaatcgatcaccatcgacgacaaggtggcgcgctcggaa
acgcagacaggataccgcaatgtcgcgcttgccaatttcatgcgcgcctaccgcaatctc
gaccatcccgtcgaccatgtgctcggcgtctatttccatcaatgcgcgctgtcgatgagc
tgcgaacagctggcccgcgccgggctgttcctggcggcccgcggcagcaatccgatgacc
ggccattcggtggtctcgccgaagcgggcgcggcgcatcaatgcgctgatgctgacctgc
ggccattacgacggctcgggcgatttcgcctatcatgtcggcctgcccggcaagagcggt
gtaggcggcggcatcttcgcggttgcgccgggcatcgcctcgatcgccgtctggtcgccg
ggcttgaacaaggtcggcaattcgcagctcggcgccgtggcgctggaaatgctggcggcg
cgcaccggctggtcggttttcggcgattga

DBGET integrated database retrieval system