KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_1988Help
Entry
Rleg2_1988        CDS       T00779                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rleg2_1988
   01230 Biosynthesis of amino acids
    Rleg2_1988
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rleg2_1988
  Energy metabolism
   00680 Methane metabolism
    Rleg2_1988
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rleg2_1988
Enzymes [BR:rlt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Rleg2_1988
Exosome [BR:rlt04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Rleg2_1988
  Exosomal proteins of melanoma cells
   Rleg2_1988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2041264..2042013
Genome map
AA seq 249 aa AA seqDB search
MRLFLVRHGESLGNLNEQAYRQFGDHNVPLTEWGHRQAVEAGSAIASYLKALPGADFGKL
QIWYSPFLRTRQSKDALLTALPESFVGEIREDYLLREQDFGLFTEIYDHAEQKQKFPEEF
EKWARLRSNSGKFYARPPDGESRADVAQRVRLFLQTVMRDAENSSHNVVIVGHGVTNRAV
EMNFLHRPVEWFERSDNPGNADITLIEGTRLQGYASILLHQAADRQPGQENELRDAYGAD
VTITPKPGG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctctttctcgttcgccacggcgaatctctcggcaacctcaacgaacaggcctat
cgccaattcggcgatcacaacgtgccgctgactgagtggggccatcgccaggcggtggaa
gccggcagcgccatcgcctcctatttgaaggcattgccgggtgcggatttcggcaagctg
cagatctggtactcgccattcctcaggacgcgacagagcaaggatgccttgctcacagcc
ttgccggaaagcttcgtcggcgagatccgggaggattacctgctgcgcgagcaggatttc
ggtcttttcaccgaaatctatgaccacgccgaacagaagcagaaatttcccgaagaattc
gaaaaatgggcgaggctgcgcagcaacagcggcaagttctacgcccggccgccggacggc
gagagccgggcggatgtagcccagcgcgtgcgcctcttcctccagaccgtcatgcgcgac
gccgaaaacagcagccacaacgtggtgatcgtcggccatggcgtcaccaaccgggccgtc
gaaatgaattttctgcaccgccccgtcgagtggttcgagcgttccgacaacccgggaaat
gccgatatcaccctgatcgaggggactcgcctgcaaggatacgcgtcgatcctgctgcac
caggccgccgaccggcagcccggacaggaaaatgaactgcgcgacgcctatggcgccgac
gtgacgatcacgccaaaacctggcgggtag

DBGET integrated database retrieval system