KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_2019Help
Entry
Rleg2_2019        CDS       T00779                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Brite
Enzymes [BR:rlt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Rleg2_2019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2081200..2082267
Genome map
AA seq 355 aa AA seqDB search
MNTAVAPKVQVPDVAGQITYAMRSMGVAPIPRNYELFYEAYIGSNPALTRELSALGSQAT
QAELDALGAQYFTSSPARVVDDAHTRISGELDGLLRILRQEQSSLESYTRLLGETHKRIT
SKSNASVELIENAIELLSQATGDTMAHGERTVEDVVQRSQEMDQVRKELDEYKRIANTDS
LTRLSNRRAFDERLAAVFNNPGMRPVTALLLADIDNFKKINDTYGHPVGDKILATVASVI
RSNVRRDVFVARAGGEEFALIIDGNTPEEITAIAERIRRTLETTPFKNSRTRVNYGPITV
SIGICMASSAEDAGELYSKTDIALYGAKNAGRNCTILYQDGMQKDFTKSWLIYKT
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaatacggctgtcgcgcccaaggtgcaggttcccgatgttgcgggccagatcacctat
gccatgcgctcgatgggcgttgcgccgataccgcgcaattacgaactcttctacgaggca
tatatcggctccaatccggcgctcacccgcgagctttcagcgctcggcagccaggcgaca
caggccgaactcgacgcgctcggcgcgcaatatttcaccagcagcccggctcgcgtcgtc
gatgacgcccatacccgcatatcaggcgaactcgacggcctgctgcggatcctgaggcag
gagcaaagttcgctcgaaagctataccaggctgctcggcgagacccataagcgcatcact
tccaagagcaatgccagcgtcgagctgatcgaaaacgccatcgaacttttgagccaggcg
accggcgacaccatggcgcatggcgaacgcaccgtcgaggacgtcgtccagcgctcgcag
gaaatggaccaagtccgcaaggaactcgacgaatacaagcggatcgccaacaccgattcg
ctgacgcgcctgtccaaccgccgcgccttcgacgaacgcctcgccgccgtcttcaacaat
cccggcatgcggccggtgacggccctgctgctcgccgacatcgacaacttcaagaagatc
aacgacacctatggccatcccgtcggcgacaagatacttgccaccgtcgcctccgtcatc
cgcagcaacgtccggcgcgacgtcttcgttgcccgtgccggcggcgaggaattcgccctc
atcatcgacggcaatacgcccgaggaaatcacggcaatcgccgagcgcatccgccgcacg
ctggaaacgaccccgttcaagaattcgcgcacgcgggttaattacggaccgatcaccgtc
tcgatcggcatctgcatggcctccagcgccgaggatgccggcgaactctacagcaagacc
gacatcgccctttacggcgccaagaatgccggccgcaactgcaccatcctctatcaggac
ggcatgcagaaggatttcaccaagagctggctgatctacaagacctga

DBGET integrated database retrieval system