KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_2019Help
Entry
Rleg2_2019        CDS       T00779                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2081200..2082267
Genome map
AA seq 355 aa AA seqDB search
MNTAVAPKVQVPDVAGQITYAMRSMGVAPIPRNYELFYEAYIGSNPALTRELSALGSQAT
QAELDALGAQYFTSSPARVVDDAHTRISGELDGLLRILRQEQSSLESYTRLLGETHKRIT
SKSNASVELIENAIELLSQATGDTMAHGERTVEDVVQRSQEMDQVRKELDEYKRIANTDS
LTRLSNRRAFDERLAAVFNNPGMRPVTALLLADIDNFKKINDTYGHPVGDKILATVASVI
RSNVRRDVFVARAGGEEFALIIDGNTPEEITAIAERIRRTLETTPFKNSRTRVNYGPITV
SIGICMASSAEDAGELYSKTDIALYGAKNAGRNCTILYQDGMQKDFTKSWLIYKT
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaatacggctgtcgcgcccaaggtgcaggttcccgatgttgcgggccagatcacctat
gccatgcgctcgatgggcgttgcgccgataccgcgcaattacgaactcttctacgaggca
tatatcggctccaatccggcgctcacccgcgagctttcagcgctcggcagccaggcgaca
caggccgaactcgacgcgctcggcgcgcaatatttcaccagcagcccggctcgcgtcgtc
gatgacgcccatacccgcatatcaggcgaactcgacggcctgctgcggatcctgaggcag
gagcaaagttcgctcgaaagctataccaggctgctcggcgagacccataagcgcatcact
tccaagagcaatgccagcgtcgagctgatcgaaaacgccatcgaacttttgagccaggcg
accggcgacaccatggcgcatggcgaacgcaccgtcgaggacgtcgtccagcgctcgcag
gaaatggaccaagtccgcaaggaactcgacgaatacaagcggatcgccaacaccgattcg
ctgacgcgcctgtccaaccgccgcgccttcgacgaacgcctcgccgccgtcttcaacaat
cccggcatgcggccggtgacggccctgctgctcgccgacatcgacaacttcaagaagatc
aacgacacctatggccatcccgtcggcgacaagatacttgccaccgtcgcctccgtcatc
cgcagcaacgtccggcgcgacgtcttcgttgcccgtgccggcggcgaggaattcgccctc
atcatcgacggcaatacgcccgaggaaatcacggcaatcgccgagcgcatccgccgcacg
ctggaaacgaccccgttcaagaattcgcgcacgcgggttaattacggaccgatcaccgtc
tcgatcggcatctgcatggcctccagcgccgaggatgccggcgaactctacagcaagacc
gacatcgccctttacggcgccaagaatgccggccgcaactgcaccatcctctatcaggac
ggcatgcagaaggatttcaccaagagctggctgatctacaagacctga

DBGET integrated database retrieval system