KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_2031Help
Entry
Rleg2_2031        CDS       T00779                                 

Definition
carbohydrate kinase FGGY
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Rleg2_2031
Enzymes [BR:rlt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Rleg2_2031
Exosome [BR:rlt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rleg2_2031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2092680..2094146)
Genome map
AA seq 488 aa AA seqDB search
MRAILAIDQGTTNSKAVLVSEKGEIVGRGSAPVGISYPKPGWVEQDPRRLYASVCEAIDA
CLRASPALTIEAVAISNQRESVTAWDAETGEALGPLVSWQCRRTAPDCERLIAKGHLDRV
QAVTGLPLDPMFPGSKFRWLLDRVPAGRSVRLGTVDSWLVHCLTGGRRHVCDASNAARSQ
LFDLREQRWSEELGEIFGVDIALLPEVLDSSADFGRTQGLPGVADGTPIMAAIGDSHAAL
FGHGAFTPGDGKVTFGTGSSVMTTLAQYIAPRNGVTTTVAWRIGGKPTFAFEGNILVCAA
SLPWMADILGLADVAALVELAESAEPGGPGFVPAFVGLGAPYWNADARALFSQINFNTTR
AQMARSVTDSIALQVHDVIAAMRAQSGGALGALYVDGGPSQNRFLMQCVSDLINHPVIQC
EAPEASALGAAYLAGLSLGLWSDLDMVAGLPRKSQTIQPQPVDRAGLLDSWNDALARSTA
RETKAKGE
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcaattctggcaatcgaccagggcacgaccaattcaaaggccgttctcgtttcc
gaaaagggagaaatcgtcggcagaggctcggctccggtcggcatctcctatccgaaaccg
ggatgggtcgaacaggacccgcgccggctctacgcgtcggtctgcgaagcgatagacgcc
tgcctgagggccagcccggctctcaccatcgaggccgtggcgatttccaaccagcgcgag
tccgtcactgcctgggacgccgaaacgggagaagcactaggaccattggtcagctggcag
tgccgccgaacggcgccggattgcgagcgtctcattgccaagggccaccttgaccgggtg
caggcggtcaccggcctgccattggatccgatgtttccgggttcgaaattccgatggctg
ctcgaccgtgttccggccggacgatcggtgcggctgggaacggtcgacagctggctggtc
cactgcctgaccggcgggcgccggcatgtttgcgatgcgtcgaatgccgccaggagccag
ttgttcgatctgcgggagcagagatggagcgaggagcttggcgagatcttcggcgtcgat
atcgcgctccttcccgaggtgctcgacagttctgccgatttcggcagaacgcagggattg
ccgggggtggcggatggcacgcccatcatggccgcgatcggcgacagccacgctgcccta
ttcggtcacggcgccttcacgccgggcgacggcaaggtgaccttcggaaccggctcttcc
gtcatgacgacgcttgcgcaatatattgccccgcgcaacggcgtcacaaccacggtcgca
tggcgtatcgggggaaagccgaccttcgctttcgaaggcaatattctcgtctgcgccgcc
agtcttccctggatggctgatattctcggccttgcggatgtggcggcgcttgtcgaactt
gcggaaagtgccgagccgggcggacccggcttcgtgccggcattcgtggggctgggagca
ccttactggaatgccgatgcccgcgccctgttctctcagatcaacttcaatacgacgcgg
gcgcaaatggcgcggtcggttaccgattccatcgccttgcaggtgcatgacgtgattgcg
gccatgcgggcacaaagcggcggtgcgctcggcgcgctctatgtggatggcggaccgagc
cagaaccgcttcctgatgcagtgtgtctccgacctcatcaaccatccggtgatccaatgc
gaagcacccgaggcatcggctttgggcgctgcttatctggcgggcctgtcacttggtttg
tggagcgatctcgacatggtcgcggggctgccgcgaaagtcgcaaaccatccagccgcaa
cccgtggatcgagcggggctgctcgatagctggaatgatgcgctcgcccgctcgacggcc
cgcgaaacaaaggctaaaggtgaataa

DBGET integrated database retrieval system