KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_2113Help
Entry
Rleg2_2113        CDS       T00779                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt00010  Glycolysis / Gluconeogenesis
rlt00071  Fatty acid degradation
rlt00350  Tyrosine metabolism
rlt00625  Chloroalkane and chloroalkene degradation
rlt00626  Naphthalene degradation
rlt01100  Metabolic pathways
rlt01110  Biosynthesis of secondary metabolites
rlt01120  Microbial metabolism in diverse environments
rlt01130  Biosynthesis of antibiotics
rlt01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rleg2_2113
  Lipid metabolism
   00071 Fatty acid degradation
    Rleg2_2113
  Amino acid metabolism
   00350 Tyrosine metabolism
    Rleg2_2113
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rleg2_2113
   00626 Naphthalene degradation
    Rleg2_2113
Enzymes [BR:rlt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Rleg2_2113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 NADH_4Fe-4S CMAS PALP MAF_flag10 adh_short
Motif
Other DBs
NCBI-ProteinID: ACI55397
JGI: Rleg22113
UniProt: B5ZSF6
Position
complement(2172478..2173506)
Genome map
AA seq 342 aa AA seqDB search
MRALQLIDDRKLEITDLPEPDAPAAGEVTLRVKAVALNHIDVWGWRGMAFAKRKMPLVIG
AEASGVVEAIGPGVANVLPGQLVSIYGARTCGLCRPCREGRDNLCEHVSGVHGFHLDGFA
QEKVNLPARLLVPAPPGVDAIGAALAPVTFGTVEHMLFDNAKLEPGETILVHAGGSGIGT
AAIQLAKKIGCTVITTVGSDDKIERAKALGADHVINYRTDRFEGVVRKLTKKKGVDVVFE
HVGKDTWAGSMLCMKRGGRLVTCGSTSGVSTEMNLMMLFQQQLKLFGSFGCRMENMADAM
QKMGRGLVHPVIDTEVSFSDIDRALERMESRQIFGKIILKMD
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgctttgcaactgatcgatgaccgcaagcttgagatcaccgacctgccggaaccg
gatgcgcctgccgccggcgaagtgacgctgcgcgtcaaggcggtggcgctcaaccatatc
gacgtctggggctggcgcggcatggcattcgccaagcgcaagatgccgctggtcatcggc
gcggaggcttccggcgtcgtcgaagcgatcgggccgggtgtcgccaacgtgctgccgggc
caactcgtttccatctacggtgcgcgcacctgcggcctctgccgcccctgccgcgaaggc
cgcgacaatctctgcgaacatgtctccggcgtgcacggcttccatctcgacggtttcgcg
caggagaaggtcaaccttccggcgcggctgctggtaccggctcctcccggcgtcgatgcc
atcggcgcggcactcgctcccgtcaccttcggcacggtcgagcacatgctgttcgacaat
gccaagcttgaacccggcgagacgatcctcgttcatgccggcggctccggcatcggcacg
gcagcgatccagctggccaagaagatcggctgcaccgtcatcaccacggtcggctcggac
gacaagatcgaaagggctaaggcgctcggcgccgatcacgtcatcaattaccgcaccgac
cggttcgaaggcgtggtgcgcaagctcaccaaaaagaagggcgtcgacgtcgtcttcgaa
catgtcggcaaggatacctgggcgggctcgatgctctgcatgaagcgtggcgggcggctc
gtcacctgcggttcgacctcgggtgtttccacggaaatgaacctgatgatgctgttccag
cagcagctgaagctgttcggctccttcggctgccgcatggagaacatggcggatgcgatg
cagaagatgggccgcgggctcgtccatcctgtcatcgatacagaggtcagcttcagcgat
atcgaccgggcgctggagcggatggagtcgcgccagatcttcggcaagatcattctgaaa
atggattga

DBGET integrated database retrieval system