KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_2323Help
Entry
Rleg2_2323        CDS       T00779                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Rleg2_2323
Enzymes [BR:rlt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Rleg2_2323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2381513..2383645)
Genome map
AA seq 710 aa AA seqDB search
MSDKTLSVWNPVKTDRFLVGAPHYPEHVDESYWERDAERMAKAGFNVVRMAEFAWHILEP
KRGTFDFDLFDRAISILGRHGIDTILCTPTATPPRWLTAAHPEILRVDGKGRPMSHGSRQ
HCDTASPVFREHSKRITKAMAEHYRDNPHVVGWQTDNELNTSMPESFSKATLSEFQAFLA
DKYGEIAKLNRAWGGDFWATAYDGFDQVVLPIEFGPTFPSPGHLQDYHRFLAFSTARFQH
DQVEILRAVKPAWFVFHNLGGLRDIDFRGQFSKDLDFVGYDIYPMLYDEFQRLGNHAKVQ
ALHLDICRGFSGNYIVPEQQSGFGSQPGFCTLTPEPGELRRMALSSVAHGADGLMFFRWR
PAHFGAEIYWMGIIDHDDIGRHRYEEAKRFAGEMIALQPKILGTYVRMDVGIAGSDFDNQ
EAHKTYPIGLPSPQDDAILMHQHCYDRGIACGFIHPEDDLSRLQLFYVPHWVMWKDEWTE
KLEAFAASGGTVVIGARTGTRDEDNHVIRQTAPGTALSKLTGVRVEDFGRLTAPGANGLF
DVMERSGGLVIPPNKPAESQRRQRRFKLGNREITAGHFYENLTVDSDVEVIAAWSNRYAE
GQAMATARKVGKGQVVYLGTYLTPELTEALTERLFPQAGIEPLVGGLPEGVEVTMRMNDE
RRLLFVQNYTDQPATIGGVPAGRDLLDGEKPVTGRLQLEGYGCAIVELEG
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgacaagaccctctccgtatggaaccccgtcaagaccgaccgcttcctcgtcggt
gcgccgcactatcccgagcatgtcgatgaaagctattgggagcgcgacgccgagcgcatg
gccaaagccggcttcaacgtggtgcgcatggccgaattcgcctggcacattctcgagccg
aagcgcggcaccttcgatttcgatctgttcgaccgtgccatatcaatcctcggccgccac
ggcatcgatacgatcctatgcacgccgacggcgacgccgccgcgctggctgaccgcagca
caccctgaaatcttaagggtcgacggcaagggccggccgatgagccacgggtcgcgccag
cattgcgatacggcaagcccggtgttccgcgagcacagcaagcgcatcaccaaggcgatg
gccgagcactatcgcgacaatccgcatgtggtgggatggcagaccgacaacgagctgaac
accagcatgccggagagcttttccaaggcgacgctcagcgaattccaggccttcctggcc
gataaatacggcgagatcgccaagctcaaccgcgcctggggcggcgatttctgggcgacg
gcctatgacggcttcgatcaggtggtgctgccgatcgagttcggcccgaccttcccgagc
cccggccatctgcaggattaccaccgcttcctcgctttctccaccgcgcgcttccagcac
gaccaggtcgaaatcctcagagccgtcaaacccgcttggttcgtcttccacaatctcggc
ggcctccgggatatcgatttccgcggccagttcagcaaggacctcgatttcgtcggctac
gacatctatccgatgctctatgacgagttccagcggctcggcaaccacgccaaggtgcag
gctctgcacctcgatatctgccgcggcttctccggcaattacatcgtgcccgagcagcaa
tcgggtttcggcagccagccgggcttctgcacgctgacgccggagccgggcgagttgcgc
cgcatggcgctctcctccgttgctcatggtgctgacggcttgatgttcttccgctggcgc
ccggcccatttcggcgccgagatctattggatgggcatcatcgaccatgacgatatcggc
cgccaccgctatgaggaggccaagcgcttcgcgggcgagatgatcgcgctgcagccgaaa
atcctcggcacctatgtccgcatggatgtcggcatcgccggctccgatttcgacaatcag
gaagcccacaagacctatccgatcggcctgccgagcccgcaggacgatgcgatcctcatg
caccagcactgctatgacaggggcatcgcctgcggcttcatccatcccgaagacgatctt
tccaggctgcagctcttctacgtcccgcactgggtgatgtggaaggacgaatggacggaa
aagctcgaagccttcgcagcctcgggcggcaccgtcgtcatcggcgcccgcaccggcacc
cgcgacgaagacaaccacgtcatccggcaaaccgcacccggcactgcgctttcaaaactg
accggcgtgcgcgtcgaagatttcggccgtctgacggcccccggcgccaacggcctgttc
gatgtgatggagcgctcgggcggtctcgtcatcccgccgaacaaacccgccgaatctcag
cgccgccagcgccggttcaaactcggcaaccgcgaaatcaccgccggccacttctatgaa
aacctcaccgtcgacagcgacgtcgaagtgatcgccgcctggtcgaaccgctatgccgag
gggcaggcgatggcgaccgcccgcaaggtcggcaaggggcaggtggtctatctcggcacc
tatctcacgcctgagctgaccgaagccctgaccgaacgcctcttcccccaggccggcatc
gagccgctggtcggcggcctgcccgaaggcgtggaggtgacgatgcggatgaacgacgag
cggcggctgctcttcgtgcagaactacacggaccagcccgcgacgatcggcggggtgccg
gccgggcgggacctgctggatggggagaagccggtaacgggcaggctgcagcttgagggc
tatggctgtgcgattgtggagctggaggggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system