KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_2566Help
Entry
Rleg2_2566        CDS       T00779                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Rleg2_2566
Enzymes [BR:rlt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Rleg2_2566
    3.5.1.-  
     Rleg2_2566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2605281..2605907
Genome map
AA seq 208 aa AA seqDB search
MKALLLVDIQNGFCPGGNLPVPDGDKVVPIANSLIDSGKYDLIVASQDWHPPGHGSFASA
HPGAAPFEMGELSGKPQMMWPDHCIQGTLDAELHPALKSEEIDLIQQKGEDPDIDSYSAF
RDNDRDASTGLAEFLEGQSVTDLDVCGLATDYCVKFSALDALEMIPGVRVRFIEDASRGI
TPEGVAAAIDEMRAHGIAIIGSAKVLAG
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgctgctgctcgtcgacattcagaacggcttctgtccgggcggcaatctgccg
gtcccggatggcgataaagtggttcctatcgcaaacagcctgatcgacagcggcaaatac
gatctgatcgtcgcctcccaggattggcacccgccgggccatggcagtttcgcctccgcc
catccgggtgcggcacctttcgagatgggcgaactgtcgggcaagccgcagatgatgtgg
cccgaccactgcattcagggcacgctcgatgccgaactgcatcccgcgctgaaatccgaa
gagatcgacctgatccagcagaagggcgaggatcccgacatcgacagctattccgccttc
cgcgacaatgaccgcgatgcctcgaccggccttgccgaattcctcgagggccagagtgtc
accgatctcgacgtctgcgggctggcgaccgactattgcgtcaagttctccgcgctcgac
gcgctggaaatgatccccggtgtccgcgtccgcttcatcgaggatgcaagccgcggcatc
acccccgaaggcgtcgccgccgccatcgacgagatgcgcgcgcatggcatcgcgatcatc
ggcagcgctaaggtgctggccggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system