KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_2599Help
Entry
Rleg2_2599        CDS       T00779                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:rlt00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:rlt00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2640043..2641560)
Genome map
AA seq 505 aa AA seqDB search
MNIDADSRGVDRLQERKVHSMKLRDLAGDQFPEIEAQLEGPAGLLDISGLSSDSRHVAPG
NAFVAVAGTKADGAGFIADAAGRGAAVAIASQAVETSIPVLAVKEPRRFLSIAASRFFGR
QPETMVAVTGTAGKTSVASFTRQIWAHAGHAAAMIGTTGVVSPTRNEYGALTTPDPVSLH
KLLAELAGEGVTHAAMEASSHGLDQSRLDGVKLAAAAFTNLGRDHMDYHPTVEAYMAAKM
RLFQLLPKGAPAVIFADDPWSAQAIKAAADAGHDVRTVGRKGDYLTLKRVEHFRHKQTAE
IHIDGEIFEVDIPLAGDFQVANALVAAGLAMSTGVEPKVAMAALEKLVGASGRLELVGHT
KDGALAYVDYAHKPDALENVLGSVRPFTTGRVVVVFGCGGDRDRGKRPIMGEIACRLADV
VIVTDDNPRSEEPAAIRAEIMAAASGASEIADRAKAIREAVGMLRSGDTLIVAGKGHEEG
QTIGSVTLPFSDHAEVRKALEELQS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcgacgccgattcgcgaggggtggaccggcttcaagagagaaaagtgcattcg
atgaaattgcgagacctggccggagatcagtttccggaaattgaagcacagctcgaaggc
ccggcaggcttgcttgatatttcaggcctgtcttcggatagccgccatgtggcgccgggc
aatgctttcgttgctgtcgccggcaccaaggcggacggcgcgggcttcatcgccgatgct
gccggccggggtgccgccgttgcgattgcttcccaggccgtcgagacttccatcccggtg
cttgcggtcaaggagccgcgccgtttcctttcgatcgccgcctcgcgcttcttcggcagg
cagccggaaaccatggtcgccgtcaccggcacggcgggcaagacctctgttgcctccttc
acccgacagatctgggcgcatgcgggccatgcggcggcgatgatcggcacgaccggtgtc
gtttcgccgacgcgcaacgaatatggtgcgctgacgacgcccgatccggtgtcgctgcac
aagctgctggccgaacttgccggcgaaggcgtgacgcatgcggcgatggaggcttccagc
cacggcctcgaccagagccggctcgacggcgtcaagcttgccgccgctgccttcaccaat
ctcggccgcgaccacatggattatcatccgactgtcgaagcctatatggccgccaagatg
cggcttttccagctgctgccgaagggcgcgcctgcggtgatcttcgccgacgatccgtgg
tcggcgcaggcgatcaaagctgccgccgatgccggtcacgatgtgcgcaccgtcgggcgc
aagggcgattaccttacgttgaagcgtgtcgagcacttccgccacaagcagaccgccgag
atccatatcgacggcgagatcttcgaggtggatattccgctggccggcgatttccaggtg
gccaacgccctggtcgcggcaggtcttgccatgtcgaccggagtcgagccgaaagttgcg
atggccgcgctcgagaaactcgtcggcgcgtccggccgtctcgaactcgtcggccatacg
aaagacggcgcgctcgcctatgtcgactatgcccataagccggacgcgctggaaaacgtg
ctgggctcggtccggcccttcaccaccggccgcgtcgtcgtggtcttcggctgcggcggc
gaccgtgatcgcggcaaacggccgatcatgggcgaaatcgcctgccgacttgccgacgtc
gtcatcgtcaccgacgataatccgcgctcggaggagccggccgcaatccgggcggagatc
atggcggcagcatccggcgcctcggaaattgccgatcgcgcgaaggcgatccgcgaggct
gtgggcatgttgcgatccggcgatacgctgatcgtcgccggcaaagggcatgaggaaggg
cagacgatcggcagcgtcaccctgccgttctccgatcatgcggaggtgcgcaaggccttg
gaggaactgcaatcttga

DBGET integrated database retrieval system