KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_2962Help
Entry
Rleg2_2962        CDS       T00779                                 

Definition
glycoside hydrolase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Brite
Enzymes [BR:rlt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Rleg2_2962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3022235..3023308
Genome map
AA seq 357 aa AA seqDB search
MNRRRFLASIPLALLYANAGDVLAQVPPARGLRAVADSKAFRFGSAIDLQNINDPIASRI
YTDNVNSITPRNELKWNATEKRPGVFSFKNADLMVAFARKNNMRVYGHTLIWYRVPEWVS
EITDAKTIQATMNRHIKQVVTRYKNSIDAWDVVNEPLEYDAPDLRDCVFRRLLGDDYIRM
SFDMAHQANPGATLVLNETHLEKKSDVFEQKRARILKIVEDLVARKTPIGAVGLQAHFRP
GLDRIDPEGMGRFCAALKDMGVGVFITELDASCHFLNRDKGFTPASYGDIFSDVITVAAE
RGDLKGVTVWGMSEKYAEPDEKAAGPDAACTKRVNLYDENNTPRSAVDGIRRAIEAM
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaagacgtttcctcgcctcgattccgcttgctctgttgtatgccaatgcgggc
gacgtcctcgcacaggtgcctccggcgagagggttgcgcgccgttgccgacagcaaggca
ttccgattcggatcggcaatcgacctgcagaacatcaacgacccaatcgcctccaggatc
tacaccgacaacgtcaattcgataacgccgcgaaacgagctgaaatggaatgcgacagaa
aagagaccgggtgtattcagcttcaagaatgccgaccttatggttgcattcgcacgcaaa
aacaacatgagggtttatggccatactttgatctggtatcgcgtcccggagtgggtgtct
gagatcaccgacgccaagacgattcaggcgacgatgaaccgtcatataaaacaggttgtc
actcgctataagaactcgatcgacgcttgggatgtggtgaacgagccgttggaatatgat
gcgccggatctgcgggattgtgttttccgacgcctccttggcgacgactatatccgtatg
agcttcgacatggcacatcaggccaatcccggtgcgacgctggtgctcaacgaaacgcat
ctggagaaaaaatccgacgtgttcgaacagaagcgcgcccgcatactgaaaatcgtcgag
gacctcgtcgcccggaaaacgccgatcggcgcggttgggctgcaggcgcatttccgtccc
ggcctcgaccgaatcgatccggaaggaatggggcgcttttgcgcggcgctgaaggacatg
ggggtcggcgttttcatcaccgaactcgatgcgtcctgccacttcctcaaccgcgacaaa
ggcttcacgccggcgtcatacggcgatattttcagtgacgtgatcaccgtggcggccgag
cgtggcgacttgaaaggcgtgacggtatggggcatgtcggaaaaatacgccgagcccgac
gagaaggcggccggtcccgacgcggcttgcacgaagcgcgttaatctttacgacgaaaac
aacacgccgagaagtgcggttgatggcatccgacgggcaatagaggcgatgtga

DBGET integrated database retrieval system