KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_3180Help
Entry
Rleg2_3180        CDS       T00779                                 

Definition
phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Pentose phosphate pathway
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:rlt00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3264963..3267347
Genome map
AA seq 794 aa AA seqDB search
MEKHVSTAALTDAELTLTDRYWRAANYLSIGQIYLLANPLLREPLKPEHIKPRLLGHWGT
TPGLNFIYAHLNRLIRARDLDVIYICGPGHGGPGMVANTYLEGSYSELYPDISEDAEGMR
KLFRQFSFPGGIPSHAAPETPGSIHEGGELGYALVHAYGAAFDNPNLIVACVVGDGEAET
GPLAASWQSNKFLNPARDGAVLPILHLNGYKIANPTILGRADGDDLKRLFEGYGYEPFFV
EGHEPHDMHQQMAATMDEVFDRIRAIQKQARNGKAAEGCPRWPMIVLRSPKGWTGPKEVD
GKKVEGFWRAHQVPVSNCRGDDGHRKILEDWMRSYDPEDLFGADGRLKPELQALAPVGKR
RMGANPHANGGLLRKELDVPDISDYAVDIGKRGSAMVQSTEILGHYLRDTMKRNAETANF
RIFGPDETESNRLGSVFEVTDRIWMEGIEPYDIHLSRDGRVMEVLSEHLCQGWLEGYLLT
GRHGLFSCYEAFIHIIDSMFNQHAKWLKVTRELEWRKPISSLNYLLTSHVWRQDHNGFSH
QDPGFVDLVANKKADIVRIYLPPDANTLLWVGDHCLRTYDRINVIVAGKQPEPQWLSMDE
AVKHCEAGIGIWHWASNEEDTISPDLVMACAGDVPTMETLAAVDLLRKAIPELKIRTVNV
VDLMALQSKDQHPHGLTDEAFDAIFTSDKPVIFAYHGYPYLIHRLTYKRTNHRNIHVRGF
IEEGTTTTPFDMTVLNQLDRFHLAIEAIERVPGLKEKASDALTAFRGQLAKHHDYVREYG
EDMPEVQSWTWPAA
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagcatgtctcgaccgccgccctgaccgacgccgaactcaccctcacggaccgc
tactggcgggccgccaattatctctcgatcgggcagatctacctgcttgccaatccgctg
ctgcgcgagccgctgaaaccggagcacatcaagccccgcctgctcggccactggggcacg
acacccggcctcaacttcatctatgcgcacctgaaccgtctgatccgcgcccgcgacctg
gacgtcatctacatatgcggccccggccatggcgggccgggcatggtggccaatacctat
ctcgaaggcagttatagcgagctctatcctgacatatcagaggatgccgaaggcatgcgc
aagctcttccggcaattctccttcccgggcggcattccgagccatgcggcgccggaaacc
cccggctccattcacgaaggcggcgaactcggttacgccctcgtccatgcctatggcgcc
gccttcgacaatcccaacctcatcgtcgcctgcgtcgtcggcgatggcgaggccgaaacc
gggccgctcgccgccagctggcaatccaacaaattcctcaatcctgcccgcgacggcgcc
gtgctgccgatcctgcatctgaacggctacaagatcgccaacccgaccattctcgggcgt
gcggatggtgatgacctcaaacgtctcttcgaaggctacggctacgaacccttcttcgtc
gaaggccatgagccgcacgatatgcatcagcagatggccgcgacaatggacgaggtcttc
gaccgcatccgcgcgatccagaagcaggcccgcaacggcaaggccgccgagggctgcccg
cgctggccgatgatcgtgctgcgcagccccaaaggctggaccggcccaaaggaggtcgac
ggcaagaaggtggaaggcttctggcgcgcccatcaggtgccggtctccaactgccgcgga
gatgatggccaccgcaagatcctcgaggattggatgcgcagctacgatccggaagatctt
ttcggcgccgacggccggctgaagcccgaacttcaggcgctggcgcccgtcggcaagcgc
cgcatgggcgccaatccccatgccaatggcggcttgctgcgcaaagaactcgatgttccc
gatataagcgactacgcggtcgatatcggcaagcgcggcagcgccatggtgcagtcgacg
gagatcctcggccattacctgcgcgacacgatgaagcgcaacgcggagaccgccaacttc
cgtatcttcggccccgatgagacggaatccaaccgtctcggcagcgtcttcgaagtcacc
gaccgcatctggatggaaggtatcgaaccttacgatatccacctctcccgggatgggcgt
gtcatggaggtgctctccgaacatctctgccagggctggctggaaggctacctgctgacg
ggccgccacggtctcttttcctgctacgaggccttcatccacatcatcgattccatgttc
aaccagcacgccaaatggctgaaggtgacgcgcgagctcgaatggcgaaagccgatctca
tcactgaactatctgctgacctcgcatgtctggcgccaggaccataacggcttcagccat
caggatccgggtttcgtcgatctcgtcgccaacaagaaggccgacatcgtccgcatctat
ctgccgccggacgccaacaccctgctctgggtcggcgaccattgcctgcgcacttacgac
cgcatcaacgtcatcgtcgccggcaaacagccggagccgcaatggctgtcgatggatgaa
gcggtgaaacactgcgaggccggcatcggcatatggcactgggcgagcaacgaggaagac
acgatttctcccgacctcgtcatggcctgcgccggcgacgtgccgaccatggaaacgctc
gctgccgtcgacctcctgcgcaaggccatccccgagctgaagatccgcaccgtcaacgtc
gttgatctgatggcactgcaatccaaggatcagcatccgcacggcctgaccgacgaggcc
ttcgatgcgatcttcacatcggacaagccggtgattttcgcctatcacggctatccctat
ctcattcaccgcctgacctataaacgcaccaaccaccgcaacatccacgtccgcggcttc
atcgaggagggcacgacgacgacacccttcgacatgaccgtcctcaaccaactcgaccgc
ttccacctcgccatcgaagcgatcgagcgagtcccgggtttgaaggagaaagcatcggat
gcactcaccgccttccgtggccagcttgcgaagcatcacgactatgtcagggagtatggc
gaggacatgccggaggtgcagagctggacgtggccggcggcataa

DBGET integrated database retrieval system