KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_3313Help
Entry
Rleg2_3313        CDS       T00779                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Rleg2_3313
   00052 Galactose metabolism
    Rleg2_3313
   00500 Starch and sucrose metabolism
    Rleg2_3313
   00520 Amino sugar and nucleotide sugar metabolism
    Rleg2_3313
Enzymes [BR:rlt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Rleg2_3313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3405864..3406751)
Genome map
AA seq 295 aa AA seqDB search
MAQHNKVRKAVFPVAGLGTRFLPATKAVPKEMLTVVDKPIIQYVVDEAIEAGIEHMVFVT
GRNKHVIEDYFDIHFELEQTLRERAKKAEITLLAQQLPKAGTVSFTRQQEPLGLGHAVWC
AREIVGDEPFALLLPDMIMKGDKGCMKGMIDLYGQSGGNIIAVEECAPDQAHKYGIVGVG
EAIGEGFRITGMVEKPAKGTAPSNFFINGRYILQPEIFRILETQERGAGNEIQLTDGMLK
LLKEQDFAGYHFRGTTYDCGAKDGFILANVAYALERADIRPTVEGGFKELLAGLR
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtggctcaacacaacaaagttcgtaaagcagtatttccggttgccggattgggaacgcga
ttcctgccagcaaccaaggctgttccgaaggaaatgttgaccgtcgtcgacaagccaatc
attcaatatgtcgtcgatgaggcgatcgaagccgggatcgaacatatggtcttcgtcacc
gggcgcaacaagcacgtcatcgaagattatttcgacatccatttcgagctggaacagacg
ctgcgcgagcgtgccaagaaggccgagatcacccttctcgcccagcaattgccgaaggca
ggtacggtaagcttcacccgccagcaggagccgctcggcctcggccatgcggtctggtgc
gcccgcgagatcgtcggcgacgagcccttcgcgctgctgctgcccgatatgatcatgaag
ggcgacaagggctgcatgaagggcatgatcgacctttacggccagagcggcggcaacatc
atcgccgtcgaagaatgtgcgcccgaccaggcccataaatatggcatcgtcggtgtcggc
gaagcgatcggcgagggcttccgaatcaccggtatggtggaaaagcccgccaagggaacg
gcgccttccaacttcttcatcaacggccgctacatcctgcagccggagattttccggatc
cttgaaacccaggaacgcggcgccggcaacgagatccagctcaccgacggcatgctgaag
ctgctgaaggaacaggatttcgccgggtatcacttccgcggcacgacctatgactgcggc
gccaaggacggcttcattttggccaatgtcgcctacgccctcgaacgcgccgatatccgt
ccgaccgtcgaaggcggcttcaaggaattgcttgccggtctgaggtaa

DBGET integrated database retrieval system