KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_3313Help
Entry
Rleg2_3313        CDS       T00779                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt00040  Pentose and glucuronate interconversions
rlt00052  Galactose metabolism
rlt00500  Starch and sucrose metabolism
rlt00520  Amino sugar and nucleotide sugar metabolism
rlt01100  Metabolic pathways
rlt01130  Biosynthesis of antibiotics
Module
rlt_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Rleg2_3313
   00052 Galactose metabolism
    Rleg2_3313
   00500 Starch and sucrose metabolism
    Rleg2_3313
   00520 Amino sugar and nucleotide sugar metabolism
    Rleg2_3313
Enzymes [BR:rlt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Rleg2_3313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 DNA_mis_repair CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACI56580
JGI: Rleg23313
UniProt: B5ZQ10
Position
complement(3405864..3406751)
Genome map
AA seq 295 aa AA seqDB search
MAQHNKVRKAVFPVAGLGTRFLPATKAVPKEMLTVVDKPIIQYVVDEAIEAGIEHMVFVT
GRNKHVIEDYFDIHFELEQTLRERAKKAEITLLAQQLPKAGTVSFTRQQEPLGLGHAVWC
AREIVGDEPFALLLPDMIMKGDKGCMKGMIDLYGQSGGNIIAVEECAPDQAHKYGIVGVG
EAIGEGFRITGMVEKPAKGTAPSNFFINGRYILQPEIFRILETQERGAGNEIQLTDGMLK
LLKEQDFAGYHFRGTTYDCGAKDGFILANVAYALERADIRPTVEGGFKELLAGLR
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtggctcaacacaacaaagttcgtaaagcagtatttccggttgccggattgggaacgcga
ttcctgccagcaaccaaggctgttccgaaggaaatgttgaccgtcgtcgacaagccaatc
attcaatatgtcgtcgatgaggcgatcgaagccgggatcgaacatatggtcttcgtcacc
gggcgcaacaagcacgtcatcgaagattatttcgacatccatttcgagctggaacagacg
ctgcgcgagcgtgccaagaaggccgagatcacccttctcgcccagcaattgccgaaggca
ggtacggtaagcttcacccgccagcaggagccgctcggcctcggccatgcggtctggtgc
gcccgcgagatcgtcggcgacgagcccttcgcgctgctgctgcccgatatgatcatgaag
ggcgacaagggctgcatgaagggcatgatcgacctttacggccagagcggcggcaacatc
atcgccgtcgaagaatgtgcgcccgaccaggcccataaatatggcatcgtcggtgtcggc
gaagcgatcggcgagggcttccgaatcaccggtatggtggaaaagcccgccaagggaacg
gcgccttccaacttcttcatcaacggccgctacatcctgcagccggagattttccggatc
cttgaaacccaggaacgcggcgccggcaacgagatccagctcaccgacggcatgctgaag
ctgctgaaggaacaggatttcgccgggtatcacttccgcggcacgacctatgactgcggc
gccaaggacggcttcattttggccaatgtcgcctacgccctcgaacgcgccgatatccgt
ccgaccgtcgaaggcggcttcaaggaattgcttgccggtctgaggtaa

DBGET integrated database retrieval system