KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_3322Help
Entry
Rleg2_3322        CDS       T00779                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Rleg2_3322
Enzymes [BR:rlt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Rleg2_3322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3420614..3421588
Genome map
AA seq 324 aa AA seqDB search
MDQVLYSTPDNPAPENRTEGFFETHDGHRLRYAVFRASAQVAKGTVVILHGRNEYIEKYF
ETIRDLTAKGLWVATFDMRGQGGSGRLLKRRNHGHIRRFGDYERDLDTFLEKVVLPDTRL
PFYLLAHSTGGLIALSAAPYLNTRIDRMVLSAPFIGLTGQSASPRVIRALAGTLTAIGLG
SLPLTSKLKEPDFRDNPLTSDETRFERNVAMMKAHPELTLGPPTARWLTEAFRTMDRVTS
PYHLFSITIPTIVIAPTRDGVVPYTAQERLSRYFRAGQLVPINGARHEIFQERDTYRAAA
LAAFHAFIPGSDAEENHDVAALGT
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggatcaggttctctattcgacgcccgacaatcccgccccggaaaaccgcacggaaggg
ttcttcgaaacccatgacggccaccggctgcggtatgccgtttttcgcgccagtgcccag
gtcgccaagggcacggtcgtcatcctgcacggccgcaacgaatatatcgagaaatatttc
gagacgatccgcgacctgacggccaaaggtctctgggtcgcaaccttcgatatgcgcggc
cagggcggttcggggcggctgctgaagcgccgcaaccacggccacatccgccgcttcggc
gattacgaacgtgatctcgacaccttcctcgaaaaggtggtgctgccggatacccgcctg
cccttctacctgctcgcccattccacaggcgggctgatcgcgctctcggccgcgccctat
ctcaacacccgtatcgatcgcatggtgctgtcggcgccctttatcggcctgaccggccag
tcggcctcaccccgcgtcatccgcgccttggccggcacgttgacggcaatcggtcttggt
tccttgccgctgacctcgaaactgaaggaaccggatttccgcgacaacccgctgacctcg
gacgaaacccgcttcgagcgtaatgtcgcgatgatgaaggcccatccggagctgacgctc
gggccgccaacggcccgctggctgaccgaggctttccggacgatggaccgggtcacctcg
ccctaccatctcttttcgatcacgatcccgaccatcgtcatcgctccgacgcgtgacggt
gtcgtgccttacaccgcgcaggagcggctctcgcgttatttccgcgccggtcaactggtg
ccgatcaacggcgcccgccacgagatcttccaggaacgcgatacctaccgcgccgccgcc
cttgccgccttccacgccttcattcccggcagcgatgccgaagagaaccacgacgtcgcc
gccctaggaacctga

DBGET integrated database retrieval system